SecReT6
Protein ID: 292489678
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3215
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3306219..3307826 [-]
Producttype VI secretion system core protein
NoteTssA
UniProt IDD4I222
KEGG IDeam:EAMY_3215
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.80E-18, Aligned region: 71..129
ImpA-rel_N [PF06812], Evalue: 8.80E-18, Aligned region: 164..180
ImpA-rel_N [PF06812], Evalue: 8.80E-18, Aligned region: 302..314
Protein Sequence: 535 a.a.     [Download]
>gi|292489678|ref|YP_003532568.1| unnamed protein product [Erwinia amylovora CFBP1430]
MSSPEALLSACTTDKKEQQHLLSRASEALSLWDNWLRPLGPEQGAGDDPAYDDNFQLMREEINKLSGTDA
QLLCELAEKCLCESAKDIRVVTWYIQARLSREGEKGLAEGLLLLAAMLSHYGKRCHPQRPNARKAALEWL
NSGKVLDALSLWPEADRNDAGLTAGAVTLLASAIADWPDSEKPSFAGLCIALENRLARSGGMEALIPQNS
GAREVGRAFVLSDSPLLSAVKSGRDLLDQARLLARWLGEQPQGWLASHRLMKTVRWDTVDQVPPLDNSGR
TRLVPPKAEYRAQLKRFYLQKNWTELVEQASQMFCEGVNHFWLDLQWYLWQGLSHGGQPWETWADSVLLD
LRLFLQRLPGLDLLAWSDGTPFADEVTQGWIAGKVNEDERVFHDDAATVANSQADDVLSLEAEAMEKGDS
ESPEAAIAWLQIRPGAETPRQRWLMRLLMARVAEQYGRNDMALHLLGELTASAPRLTLVDWEPALLFEVQ
ARRLKLLRMKAGRSAAEKALMMPEMDTLLAGLIAIDPARAMVLCG
 
Nucleotide Sequence: 1608 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3307826-3306219 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAGTTCGCCAGAAGCGTTGTTATCAGCCTGCACCACAGACAAGAAAGAGCAGCAGCATCTTCTCTCGC
GGGCATCTGAAGCCCTGTCACTTTGGGATAACTGGTTACGTCCTCTCGGCCCGGAACAGGGAGCCGGAGA
CGATCCGGCCTATGATGATAACTTCCAACTGATGCGCGAAGAAATCAACAAACTTTCCGGTACCGATGCG
CAACTGCTGTGTGAGCTGGCGGAAAAATGCCTGTGCGAGAGCGCCAAAGATATCCGGGTAGTGACCTGGT
ACATTCAGGCCCGTCTGAGCCGTGAGGGCGAGAAAGGGCTGGCGGAGGGCTTATTGCTGTTGGCTGCCAT
GCTGTCCCATTACGGAAAACGGTGCCATCCACAGCGCCCCAACGCCCGCAAGGCTGCGCTGGAGTGGCTG
AACAGTGGCAAAGTGCTCGACGCACTGTCGCTATGGCCGGAGGCGGACCGCAACGACGCGGGCCTGACTG
CCGGAGCCGTTACTCTGCTTGCTTCCGCTATTGCTGACTGGCCGGATAGCGAAAAACCATCCTTTGCAGG
ACTCTGTATCGCACTGGAAAATCGCCTGGCACGTTCAGGAGGCATGGAGGCATTGATTCCCCAAAACAGT
GGTGCCCGGGAAGTGGGTCGCGCATTCGTCCTTTCCGATTCACCACTGTTGTCTGCCGTGAAGTCCGGTC
GCGACTTGCTTGACCAGGCCAGGTTGCTTGCCCGCTGGCTGGGCGAGCAACCCCAGGGCTGGCTCGCCTC
GCACCGACTAATGAAAACCGTGCGCTGGGACACGGTCGATCAGGTCCCGCCGCTGGACAACAGTGGACGG
ACCCGGCTGGTGCCGCCCAAAGCGGAATACCGTGCGCAGTTAAAGCGCTTTTATCTGCAGAAAAACTGGA
CTGAGCTGGTGGAGCAGGCCAGCCAGATGTTCTGCGAAGGGGTTAACCACTTCTGGCTCGATCTCCAGTG
GTATCTCTGGCAGGGACTCAGTCACGGCGGTCAGCCGTGGGAAACCTGGGCTGATTCTGTCCTGCTGGAT
TTGCGACTGTTCCTGCAACGTCTGCCCGGGCTGGATCTGCTTGCCTGGAGCGATGGCACCCCGTTTGCCG
ATGAGGTTACACAGGGTTGGATAGCCGGGAAGGTGAATGAGGATGAGAGGGTATTCCATGATGACGCTGC
CACGGTAGCCAACAGCCAGGCGGATGATGTGCTGTCGCTGGAGGCGGAGGCGATGGAAAAGGGTGACAGC
GAGAGCCCGGAAGCCGCGATCGCCTGGCTTCAGATCCGACCTGGCGCGGAGACACCACGCCAACGCTGGC
TGATGCGCCTGCTGATGGCCCGGGTGGCCGAACAGTACGGTCGCAACGACATGGCCTTGCATCTGCTGGG
TGAACTGACCGCCAGCGCCCCGCGGCTGACGTTGGTTGACTGGGAGCCTGCCCTGTTGTTTGAAGTGCAG
GCCCGTCGCCTGAAGCTGTTACGCATGAAAGCCGGCCGCAGCGCGGCCGAAAAAGCCCTTATGATGCCCG
AAATGGACACCTTGCTGGCTGGCCTTATCGCTATCGACCCTGCCCGGGCCATGGTGCTCTGTGGCTAA