SecReT6
Protein ID: 292489681
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3218
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3312398..3312667 [-]
Producthypothetical protein
NotePAAR
UniProt IDD4I225
KEGG IDeam:EAMY_3218
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-21, Aligned region: 6..82
Protein Sequence: 89 a.a.     [Download]
>gi|292489681|ref|YP_003532571.1| unnamed protein product [Erwinia amylovora CFBP1430]
MLMIIRKGNTTTHGGSVITASDTMKFGGISIARKGDEVSCLLEGHGPTTIIEGNRNPDYHDCVIPVAFHG
HQCGGGCTWVSSTVAVRVG
 
Nucleotide Sequence: 270 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3312667-3312398 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGCTTATGATTATCCGTAAAGGTAATACAACCACTCACGGCGGTTCGGTGATAACCGCATCCGACACTA
TGAAATTCGGCGGTATCAGTATTGCCCGTAAAGGCGACGAAGTTTCTTGTCTGCTTGAAGGCCATGGCCC
CACTACCATCATTGAAGGAAACCGAAATCCGGATTATCACGATTGTGTTATTCCTGTGGCGTTTCACGGC
CATCAATGCGGTGGTGGCTGCACATGGGTCAGCTCAACTGTCGCGGTAAGGGTTGGCTGA