SecReT6
Protein ID: 292489683
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3220
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3313420..3315777 [-]
Producttype VI secretion system effector protein VgrG
NoteTssI
UniProt IDD4I227
KEGG IDeam:EAMY_3220
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.50E-62, Aligned region: 41..355
DUF2345 [PF10106], Evalue: 2.10E-41, Aligned region: 610..753
T6SS_Vgr [PF13296], Evalue: 2.40E-36, Aligned region: 486..591
T6SS_Vgr [PF13296], Evalue: 2.40E-36, Aligned region: 634..653
Phage_base_V [PF04717], Evalue: 4.40E-15, Aligned region: 400..481
Phage_base_V [PF04717], Evalue: 4.40E-15, Aligned region: 752..766
Protein Sequence: 785 a.a.     [Download]
>gi|292489683|ref|YP_003532573.1| unnamed protein product [Erwinia amylovora CFBP1430]
MSNSVINLTGQKTQQLPGQSRYRMDVHNCPHCLDVLSFRAEESFSRPWHYAVSLTCQTPDLNCDTLLLKP
ASFTCQTPLFSGAPAAPVRTVFGVVSAFRRLSTSEDETRYALTLVPRIALLAHTKGSEVFLNQSVIEVVE
QVLRKHGLEGPDFEFRLSREYPARELITQWRETDLEFVQRLLAEVGIFWRFEMDGRLEQDVVIFQDSQEQ
YQFGVTLPLRNPAGMSDSGQESIWGIHTAYNVVSGRVTTRDYNYREALTPQDSSESISGKEGITTGEVCH
YAEPFLTAGDTDNTETGAYFARLRHERILNGQSTVSGRSSSPFLAPGQVLEADTRLPDAVKDGIVITTVR
SSGSRKSSFTLTFEGIPYSETVCYRPALINRPVISGSLPARVESAQKGDIYAWLDEQGRYRVRMDFDRNS
TEQGYAYLWLRMAKPYAGDTYGWHAPLLDGTEVSVVFDSGDPDRPYIACAQHDSEHPDHVTSDNPTRNIW
RTPANNKLRMEDKRQEEHIKLATEYGKTQLNLGHLVNAQREQRGAGFELRTDEFGVVRAGKGLFLTADEQ
LKAQGPVLEMKQAINQINQANSQMQSLNSAAEAAGALVSDISTQISLVTERLKNLQSAVLLASAPQGVAL
TSGEHLQLTSTRNTMINAGQHLDIGAMKNLSISVEKALGLFVHKDGAKLIANQGDVEIQARHNTMALFAR
QQITVTSSDDEIVISTPKTLTLNGGGSYLKLSQNGIEHGSCGDYLIKAAHYQVLVGGASLDTERPVFDKT
SLELLPPVTDDDMSR
 
Nucleotide Sequence: 2358 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3315777-3313420 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAGTAATAGTGTAATTAATCTGACTGGACAAAAAACACAGCAACTTCCCGGCCAGTCCCGATACCGTA
TGGATGTACATAACTGCCCGCATTGTTTGGATGTGTTGAGTTTTCGGGCAGAAGAATCATTCAGCCGGCC
CTGGCACTACGCGGTGTCACTCACTTGCCAAACGCCGGATCTCAACTGCGACACGCTGCTGCTGAAACCC
GCCTCATTTACCTGTCAGACGCCGTTGTTTAGCGGTGCGCCTGCCGCGCCGGTGCGTACCGTTTTTGGCG
TGGTGAGCGCGTTTCGCCGCTTATCCACCTCTGAAGATGAAACCCGATATGCATTGACGCTGGTGCCGCG
GATTGCCCTGTTAGCGCACACGAAAGGCAGTGAAGTTTTTCTCAACCAGTCCGTTATCGAAGTGGTGGAG
CAGGTATTGCGCAAGCATGGTCTGGAGGGGCCTGACTTTGAGTTCCGCCTGTCGCGTGAGTACCCAGCCC
GCGAGCTTATTACCCAGTGGCGGGAAACCGATCTTGAATTTGTGCAGCGCCTGCTGGCAGAGGTGGGGAT
TTTCTGGCGCTTTGAAATGGACGGCCGACTTGAACAGGACGTGGTGATATTCCAGGATAGCCAGGAGCAG
TATCAGTTCGGCGTGACCCTGCCGCTGCGCAACCCTGCCGGGATGAGCGACAGCGGCCAGGAAAGCATCT
GGGGCATCCACACCGCTTACAACGTGGTGAGTGGCCGTGTCACCACCCGTGATTACAACTACCGCGAGGC
GCTTACGCCGCAGGACAGCTCGGAAAGCATCAGCGGTAAAGAAGGCATCACTACCGGTGAGGTTTGTCAT
TACGCGGAGCCATTCCTCACTGCCGGCGATACTGATAACACGGAAACAGGGGCTTATTTTGCCCGACTGC
GACACGAACGTATTCTGAACGGGCAATCTACCGTCAGCGGCCGTTCCTCCAGCCCCTTTCTGGCCCCCGG
ACAGGTGTTGGAAGCCGATACCCGTCTGCCTGATGCCGTAAAAGACGGCATTGTTATCACCACTGTACGC
AGCAGTGGTTCACGTAAAAGCAGCTTCACGCTCACGTTTGAAGGTATTCCGTACAGCGAAACCGTCTGCT
ACCGCCCGGCGCTCATCAATCGCCCGGTCATTTCCGGTTCCCTGCCGGCCCGTGTGGAAAGCGCCCAAAA
AGGCGATATCTACGCCTGGCTGGACGAGCAGGGGCGCTACCGCGTGAGGATGGACTTCGACCGCAACAGC
ACCGAACAAGGTTATGCATATCTGTGGCTGCGGATGGCAAAGCCGTATGCCGGCGATACCTACGGCTGGC
ATGCGCCGCTTCTCGACGGCACGGAAGTGTCCGTGGTGTTTGACAGCGGCGACCCGGATCGCCCGTATAT
CGCCTGTGCCCAGCACGATTCCGAACATCCCGACCACGTCACCAGCGATAACCCTACGCGCAACATCTGG
CGCACACCGGCAAATAACAAGCTACGCATGGAGGATAAGCGCCAGGAAGAGCATATCAAGCTCGCCACGG
AATACGGCAAGACCCAGCTCAACCTGGGCCACCTGGTCAACGCACAGCGTGAACAACGTGGGGCGGGTTT
TGAATTACGCACTGACGAATTCGGCGTGGTTCGTGCAGGAAAAGGCCTGTTCCTGACGGCGGATGAACAG
CTGAAAGCACAGGGGCCGGTGCTGGAAATGAAACAGGCTATAAACCAGATTAATCAGGCCAACAGCCAGA
TGCAGTCACTGAACAGTGCCGCAGAAGCCGCAGGGGCGCTGGTATCAGACATCAGCACCCAGATAAGCCT
GGTGACAGAACGGCTTAAAAACCTTCAGTCCGCCGTTCTGCTGGCCAGTGCACCGCAGGGCGTGGCGCTG
ACCTCAGGTGAGCACCTACAGCTCACCAGCACCCGTAACACCATGATTAACGCGGGCCAGCACCTTGACA
TCGGGGCAATGAAAAACCTGTCCATCTCGGTTGAAAAAGCGCTGGGGCTGTTCGTGCATAAAGACGGCGC
TAAGCTGATCGCCAATCAGGGAGATGTGGAAATTCAGGCCCGGCACAACACCATGGCGCTCTTCGCCAGG
CAGCAAATAACGGTCACCAGCAGCGATGACGAAATTGTTATCAGCACGCCGAAAACGCTGACGCTGAACG
GCGGCGGTTCGTACCTTAAGTTGAGTCAGAATGGGATCGAACATGGATCTTGCGGTGATTATCTGATCAA
AGCCGCCCACTACCAAGTGCTTGTGGGGGGAGCTTCATTGGATACCGAAAGGCCGGTTTTTGACAAGACT
TCTCTTGAGCTTTTGCCCCCTGTAACCGATGACGATATGTCACGCTAA