SecReT6
Protein ID: 292489686
SecReT6 ID387
T6SS typei2
Gene symbolhcp
Locus tagEAMY_3223
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3319049..3319540 [-]
Producttype VI secretion system effector protein hcp
NoteTssD
UniProt IDD4I230
KEGG IDeam:EAMY_3223
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|292489686|ref|YP_003532576.1| hcp gene product [Erwinia amylovora CFBP1430]
MAIPIYLWLKDDGGAAIKGSVNVKDREGSIEVLSQDHSLYMPTDNNTGKLTGTRIHTPFQFSKEIDSSSP
YLYRAVTSGKKLKSAEFKWYRINDAGQEVEYFNTRLEDVKLVKVAPKMHDIKDPTKEKHNHLEIIELRYE
KITWTYKDGNIIYSDSWDDRPSA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3319540-3319049 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGGCAATTCCAATTTATCTATGGCTGAAAGACGACGGCGGCGCGGCCATTAAAGGCTCCGTAAATGTTA
AAGACCGTGAGGGCAGCATCGAAGTTCTCTCGCAGGATCATAGCCTGTATATGCCAACCGATAACAATAC
CGGCAAACTGACGGGCACCCGCATTCATACCCCGTTCCAGTTTAGCAAAGAAATCGATTCCTCCAGCCCG
TACCTGTACAGAGCGGTAACCTCTGGCAAAAAGCTGAAGTCTGCCGAGTTCAAGTGGTACAGAATCAACG
ATGCGGGTCAGGAAGTGGAGTATTTCAATACCCGACTTGAGGACGTCAAGCTGGTAAAGGTCGCGCCAAA
AATGCACGACATTAAAGACCCGACCAAAGAGAAGCATAATCACCTCGAAATCATCGAGCTGCGTTATGAA
AAAATCACCTGGACCTATAAAGACGGCAACATCATTTATTCCGATTCCTGGGACGATCGCCCCAGCGCGT
AA