SecReT6
Protein ID: 292489687
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3224
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3319573..3321228 [-]
Producttype VI secretion system-associated protein
NoteTagL
UniProt IDD4I231, D4I231
KEGG IDeam:EAMY_3224
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.10E-15, Aligned region: 431..527
Protein Sequence: 551 a.a.     [Download]
>gi|292489687|ref|YP_003532577.1| unnamed protein product [Erwinia amylovora CFBP1430]
MRPSAIASVVLHILTGAAALLWLLWYFIPLGNLFRLMLTLLVVAVAGWLAWKGCRYRKVPADGALSSIEI
PTLDTQKPVVLVCGEGLDSLFPVQNLRKTAQGWWLRVGNISQLKDAVRLVLEQQFRQAGQLSVMYVCLPD
QHQDEAVLRASISALRQQISQLTTLTGFALPVVLHCAFSGPQTPWVIVRGDKPLVCAANELPQALVDWQQ
TGNNLSMLPVLGQAFTFIHDTLLDEMAKADRLIPPVAPFAVALRTGAASAESHSVWAQWLYRRTCLQFPP
VKGGLELACPFPDAVLPLLAPFASPVQGGQRSRRVVLLLWLCALAALVFSAANNLALIRLVAADLQRWSA
IPMTHYAPKAQSLIALKQHVLMLERWQRQGEPMRYGLGYYPGQRLWLVLQQAIDSWVPAPPSLIPVEKDT
PQAVRLDALSLFDTGKYQLKPNSTKMLVKALMGIKAKPGWLIVVAGHTDNTGEANANQVLSHKRAEALRH
WMLSTSDVSPTCFAVQGYGATRPIASNDTVEGREANRRVEISLVPQVDACQTPAPQGPSND
 
Nucleotide Sequence: 1656 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3321228-3319573 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGCGCCCCTCTGCTATTGCCTCTGTTGTATTACACATCCTGACGGGAGCGGCAGCGCTGTTGTGGCTGC
TTTGGTATTTCATTCCGCTGGGCAATCTGTTCAGGTTGATGCTCACCCTGCTGGTTGTCGCAGTTGCAGG
TTGGCTGGCGTGGAAAGGTTGTCGTTACCGTAAAGTGCCCGCAGACGGCGCACTTTCATCCATTGAGATC
CCCACTTTAGACACGCAGAAACCTGTGGTGCTGGTGTGTGGTGAGGGGCTGGATAGCCTGTTTCCGGTGC
AGAATCTGCGAAAAACAGCCCAGGGTTGGTGGTTGCGCGTCGGCAACATCAGCCAGCTTAAAGACGCGGT
GCGCCTTGTGCTGGAACAACAATTTCGCCAGGCAGGCCAGCTTTCGGTGATGTACGTTTGCCTCCCTGAC
CAACATCAGGATGAGGCCGTTTTACGGGCATCGATTAGCGCTTTGCGGCAGCAAATCAGCCAACTGACTA
CGCTGACCGGTTTTGCCTTACCTGTTGTTCTGCACTGCGCATTCTCCGGTCCGCAAACGCCCTGGGTGAT
CGTTCGCGGAGACAAACCGCTGGTATGTGCCGCCAATGAGCTGCCCCAGGCGCTGGTCGACTGGCAGCAG
ACGGGAAATAACCTCTCAATGCTACCGGTCCTTGGCCAGGCTTTCACCTTTATCCATGACACGCTGCTTG
ATGAGATGGCGAAAGCGGACCGCTTAATCCCGCCCGTTGCTCCGTTTGCTGTCGCTTTGCGTACCGGTGC
GGCATCCGCAGAGTCTCATTCAGTATGGGCACAGTGGCTTTATCGCCGAACCTGTTTGCAATTTCCACCG
GTGAAGGGGGGCCTGGAGCTGGCCTGCCCCTTTCCCGATGCCGTTCTGCCTTTACTGGCTCCTTTTGCCT
CGCCGGTACAAGGCGGTCAACGCAGCCGCCGCGTTGTGCTTCTGCTTTGGCTTTGCGCCCTGGCCGCGCT
GGTTTTTTCTGCAGCCAATAACCTGGCTCTCATTCGTCTGGTGGCTGCTGACCTGCAGCGTTGGTCCGCC
ATTCCGATGACTCATTACGCGCCCAAGGCGCAATCCCTCATTGCTCTGAAGCAGCATGTACTGATGCTTG
AACGCTGGCAGCGCCAGGGTGAGCCAATGCGTTACGGCCTGGGGTATTACCCGGGACAACGTCTGTGGCT
GGTTCTTCAACAGGCTATTGATAGCTGGGTTCCGGCGCCCCCCTCTTTAATACCTGTTGAGAAAGACACG
CCACAAGCCGTGCGTCTCGATGCCCTGTCGCTGTTTGATACCGGTAAGTATCAGCTTAAACCGAACAGCA
CCAAAATGTTGGTAAAGGCGTTGATGGGCATTAAGGCCAAACCCGGTTGGCTGATTGTGGTCGCGGGTCA
TACCGACAACACCGGGGAGGCTAATGCGAACCAGGTACTGTCGCATAAACGTGCTGAAGCACTTCGTCAC
TGGATGCTGTCGACCAGTGATGTATCACCCACCTGCTTTGCCGTTCAGGGCTACGGCGCAACGCGCCCAA
TCGCTTCTAACGACACGGTGGAAGGCCGTGAGGCCAACCGCCGTGTTGAAATTAGTCTGGTGCCACAGGT
TGATGCCTGTCAAACACCCGCACCTCAAGGCCCATCAAATGATTGA