SecReT6
Protein ID: 292489688
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3225
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3321228..3321905 [-]
Producttype VI secretion system-associated protein
NoteTssL
UniProt IDD4I232
KEGG IDeam:EAMY_3225
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.50E-43, Aligned region: 7..212
Protein Sequence: 225 a.a.     [Download]
>gi|292489688|ref|YP_003532578.1| unnamed protein product [Erwinia amylovora CFBP1430]
MRQEIDIDQLMTETWLTVTLLRRGATTLDGAALYDNCTKQVENAREALQRAGYDEASIGHITYAQCALLD
EAVMSRKSVENAHRLDDSQVAWRKAPLQARFFGSLHAGEALWERIAEVLRQPAPDNAVLTCYHRVIALGF
QGLYSVETVSQEQRGEVIKALSERVPMPDADLSLVIHRTAKHRYSMVRSVWFWVIMTAVLTAGVWWGGHL
WLQALLSAQIPELRR
 
Nucleotide Sequence: 678 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3321905-3321228 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAGACAAGAAATCGATATCGACCAACTGATGACGGAAACCTGGCTGACCGTCACCTTACTGAGGCGGG
GGGCCACCACGCTGGACGGCGCAGCGCTTTATGATAACTGCACGAAGCAGGTTGAAAACGCCCGTGAGGC
GCTGCAACGCGCAGGGTACGACGAAGCCAGCATTGGGCATATCACCTACGCCCAGTGCGCCCTGCTGGAT
GAAGCGGTGATGAGTCGAAAATCCGTGGAGAATGCACACCGGCTGGATGACAGCCAGGTGGCCTGGCGTA
AAGCGCCGCTTCAGGCGCGTTTTTTTGGCTCCCTGCATGCCGGTGAGGCGCTTTGGGAGCGTATTGCGGA
AGTGCTGCGGCAGCCTGCACCGGATAACGCGGTGCTGACCTGTTATCACCGCGTCATTGCGTTGGGCTTC
CAGGGGCTGTACAGCGTGGAGACCGTCAGCCAGGAACAGCGGGGAGAGGTGATTAAGGCACTTTCTGAAC
GGGTGCCGATGCCTGATGCGGATCTGTCTCTGGTGATCCACCGGACCGCTAAACACCGCTACAGCATGGT
GCGCTCAGTTTGGTTCTGGGTAATCATGACGGCCGTACTGACGGCGGGAGTCTGGTGGGGCGGGCACCTT
TGGCTCCAGGCGCTGCTATCTGCGCAAATACCGGAGCTGCGACGTTAA