SecReT6
Protein ID: 292489689
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3226
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3321902..3323251 [-]
Producttype VI secretion system core protein
NoteTssK
UniProt IDD4I233
KEGG IDeam:EAMY_3226
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.90E-121, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|292489689|ref|YP_003532579.1| unnamed protein product [Erwinia amylovora CFBP1430]
MKIYRPLWNEGALLSPQQFQQQSEWESFRSAGISALASPFPWGVETLKFDDPLLASGLIQISPLRLWLED
GSLIDAQCSDLPPVPRELNSAQLAGLDAVTVVIALPLMQQGVNNVQQDAEMSDRPQRYREEWLPVQDAFG
TEEEFMAVARFNYSIRFAHENNASWRTCPVARLIWDGQNGWRQDAAFIPPVALFSASPMLCERLVLLNRQ
LRSRRQRLMAMRRESNERLADFAVADVSLFWLLNALNSHARVLSEYERFPARHPEQVWAELARLAGSLLT
FSLNHDLDAIPGYDHAEPAHTFPPLFELITGLLEASLPSRVIALEMSRPDEQTWKASLHDIRLREEADLY
LSVRSDIPAWQLADKFPALCQAGSPDDVKEIYSAALKGIPLIAVSRVPAALPVRMENQYFALDMESPAAR
EMQDQGVCMFYVPALLGRLELELFAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3323251-3321902 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAAAATTTATCGTCCATTGTGGAATGAGGGGGCGCTGCTGTCCCCCCAGCAATTCCAGCAGCAGTCGG
AATGGGAGTCTTTTCGCAGTGCGGGGATCTCTGCACTGGCCTCGCCATTTCCGTGGGGAGTGGAAACGCT
AAAGTTTGATGACCCCCTGCTGGCTTCCGGGCTGATCCAGATCTCACCGCTGCGTCTCTGGCTGGAAGAT
GGCTCCCTTATCGATGCGCAATGCAGCGATCTGCCGCCTGTACCACGAGAACTCAATTCCGCTCAGTTGG
CGGGTCTTGATGCGGTCACTGTCGTTATTGCGCTGCCCCTGATGCAGCAAGGTGTGAACAACGTTCAGCA
AGATGCGGAGATGTCAGACAGACCGCAGCGCTATCGCGAAGAGTGGCTACCGGTTCAGGATGCTTTCGGC
ACGGAAGAAGAGTTCATGGCCGTCGCCCGCTTCAATTACTCCATCCGGTTTGCCCATGAAAATAACGCGT
CGTGGCGAACCTGCCCTGTGGCGCGTCTGATTTGGGACGGACAGAACGGATGGCGTCAGGACGCGGCGTT
TATTCCTCCTGTGGCCTTATTCTCCGCCAGCCCGATGCTGTGCGAACGCCTGGTTCTGCTCAATCGCCAG
CTTCGCTCCCGCCGTCAGCGCCTGATGGCTATGCGTCGTGAGAGTAATGAACGTCTGGCTGATTTCGCCG
TTGCCGATGTTTCGCTGTTCTGGTTGCTGAACGCGCTTAATTCCCATGCGCGGGTGCTGTCGGAATACGA
ACGCTTTCCGGCCAGGCACCCGGAGCAGGTGTGGGCAGAGCTTGCCAGGCTGGCGGGCAGCCTGCTGACC
TTTTCTCTCAACCACGATCTGGACGCTATTCCCGGCTATGACCACGCTGAACCGGCCCATACTTTCCCGC
CGCTGTTTGAACTGATAACCGGTTTGCTGGAAGCCAGCCTGCCGTCGAGGGTGATCGCACTTGAGATGTC
GCGTCCGGATGAGCAGACGTGGAAAGCCTCTTTACACGATATCCGTTTGCGCGAAGAGGCCGACCTGTAC
CTCTCCGTGCGCTCAGATATTCCAGCCTGGCAGCTCGCCGATAAGTTTCCTGCACTTTGTCAGGCCGGTT
CACCCGATGACGTGAAAGAAATCTACAGCGCCGCACTCAAGGGGATCCCACTTATTGCCGTCAGCCGCGT
ACCGGCAGCATTGCCGGTACGCATGGAAAACCAGTACTTCGCGCTGGATATGGAAAGCCCCGCTGCCCGC
GAGATGCAGGATCAGGGCGTGTGCATGTTCTATGTGCCTGCTTTGCTGGGCCGGCTGGAGCTTGAGCTGT
TTGCGGTGCTGCGATCATGA