SecReT6
Protein ID: 292489690
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3227
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3323269..3324816 [-]
Producttype VI secretion system core protein
NoteTssC
UniProt IDD4I234
KEGG IDeam:EAMY_3227
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-172, Aligned region: 89..511
APG6 [PF04111], Evalue: 0.0052, Aligned region: 41..102
Protein Sequence: 515 a.a.     [Download]
>gi|292489690|ref|YP_003532580.1| unnamed protein product [Erwinia amylovora CFBP1430]
MLMSVKNDNAAGGENIVLERAKAGSVYASLFEKINLNPVSKLSALDIWQDNQAMSDATADERLTAGMRVF
LDCLSKAGSKVEKLDKSLIDHHIAELDYQISRQLDAVMHHEAFQRVESLWRGVKSLVDKTDFRQNVKIAL
LDLSKEDLRQDFEDAPEIIQSGLYQHTYTAEYDSPGGEPVAALISAYEFDASAQDVALLRHISNVSAAAH
MPFIGSAGAQFFLKESMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTMPV
RSFNYVEEVKGPDHNKYLWTNASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKI
PSEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSTQKPVRYDTADATANSRINSRLPYILLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDSLQASHPLRDARVVVEDIEDNPGFFRVRLF
AVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1548 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3324816-3323269 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGCTGATGTCGGTAAAAAATGATAACGCCGCTGGTGGTGAAAACATCGTGCTGGAGCGTGCGAAAGCGG
GCAGCGTGTACGCCTCCCTGTTTGAGAAAATTAACCTGAATCCGGTATCAAAGTTGAGCGCGCTGGATAT
CTGGCAGGATAATCAGGCGATGTCGGATGCAACGGCCGATGAGCGTCTGACCGCCGGCATGCGGGTGTTC
CTGGATTGCCTGAGTAAAGCGGGTTCGAAGGTTGAAAAGCTGGATAAGAGCCTGATTGACCACCATATCG
CGGAGCTGGACTACCAGATTAGCCGCCAGCTGGACGCGGTGATGCATCATGAAGCATTCCAGCGCGTCGA
ATCCCTGTGGCGCGGAGTAAAATCACTGGTAGATAAAACCGATTTCCGTCAGAACGTCAAAATCGCGCTG
CTTGACCTGTCGAAAGAGGATTTGCGTCAAGATTTTGAAGACGCGCCGGAAATTATACAGAGCGGGTTGT
ACCAGCACACGTACACGGCCGAGTACGACAGCCCGGGCGGAGAGCCTGTTGCCGCGCTGATTTCCGCCTA
CGAGTTTGATGCGTCGGCTCAGGACGTGGCGCTGCTGCGTCATATCTCCAACGTTTCTGCCGCTGCGCAT
ATGCCGTTTATCGGTTCGGCCGGAGCGCAATTCTTCCTGAAAGAGTCGATGGAAGAGGTGGCGGCGATCA
AAGACATTGGCAACTACTTCGACCGCGCCGAGTACATCAAATGGAAATCCTTCCGTGATACCGACGACTC
CCGCTATGTCGGCCTGGTAATGCCGCGCGTGCTGGGGCGCTTGCCGTATGGCCCGGACACCATGCCGGTG
CGCAGCTTCAACTACGTGGAGGAAGTGAAAGGCCCGGACCATAACAAATACCTGTGGACTAACGCCTCGT
TTGCTTTTGCGGCCAACATGGTGAAAAGCTTTATCAACAACGGCTGGTGCGTACAAATTCGTGGCCCGCA
GGCCGGTGGCGCGGTGCAGGATCTGCCGATTCATCTGTACGACCTGGGCACCGGCAATCAGGTGAAGATC
CCCTCTGAGGTGATGATCCCGGAAACCCGTGAGTTTGAATTTGCTAACCTCGGTTTTATTCCGCTGTCGT
ACTACAAAAACCGCGACTATGCCTGCTTTTTCTCGGCCAATTCCACGCAAAAGCCGGTGCGGTATGATAC
GGCTGATGCGACGGCCAACAGCCGCATCAACTCGCGTCTGCCGTACATCTTGCTGCTATCGCGCATTGCT
CACTACCTGAAGCTTATTCAGCGCGAAAACATCGGTACGACTAAAGACCGCCGCCTGCTGGAGTTGGAGC
TGAATACGTGGGTGCGTGGGTTGGTGACTGAAATGACCGATCCGGGTGATTCACTTCAGGCATCACATCC
GCTGCGTGATGCCAGAGTGGTGGTGGAAGATATCGAGGACAACCCGGGCTTCTTCCGCGTGAGGCTGTTT
GCAGTACCGCACTTCCAGGTGGAAGGCATGGACGTCAATCTGTCGCTGGTGTCGCAGATGCCAAAAGCCA
AGGCATAA