SecReT6
Protein ID: 292489691
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3228
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3324851..3325348 [-]
Producttype VI secretion system core protein
NoteTssB
UniProt IDD4I235
KEGG IDeam:EAMY_3228
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.50E-54, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|292489691|ref|YP_003532581.1| unnamed protein product [Erwinia amylovora CFBP1430]
MSNSWQSEIPKARVNIQLSLHTGGAQKKVELPLKLMVVGDYSNGAEQRAVSEREPVSVDKNNFNSVLSEF
SPSLDISVENTLAGDGSEENVSLSFGEMKDFGPEQVARQIPQLKAMLAMRNLLRDLKANLLDNVTFRKEL
EKILLDPTLSAELRSELSALAPKNA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3325348-3324851 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGTCTAACTCCTGGCAGTCCGAGATCCCCAAGGCTCGCGTTAACATTCAGTTAAGTCTGCACACGGGTG
GCGCGCAGAAAAAAGTGGAATTACCCCTCAAGTTGATGGTGGTAGGCGATTACAGCAACGGCGCTGAACA
GCGTGCGGTATCTGAGCGTGAACCTGTCAGCGTCGATAAAAACAACTTCAACAGCGTGCTGTCCGAATTC
TCTCCCTCCCTGGATATTTCCGTGGAAAACACGCTGGCGGGTGACGGCAGTGAAGAAAATGTCAGCCTCT
CTTTCGGTGAGATGAAAGACTTCGGGCCGGAGCAGGTAGCCCGCCAGATACCCCAGCTCAAAGCCATGCT
GGCCATGCGCAATCTGCTTCGCGACCTGAAAGCAAACCTGCTGGACAACGTGACCTTCCGCAAGGAGCTG
GAAAAAATCCTGCTTGACCCAACGCTCAGTGCTGAACTGCGCAGCGAGCTGTCTGCCCTGGCACCGAAAA
ACGCCTGA