SecReT6
Protein ID: 292898093
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0367
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]446034..446531 [+]
Producthypothetical protein
NoteTssB
UniProt IDD4IE19
KEGG IDeay:EAM_0367
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.50E-54, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|292898093|ref|YP_003537462.1| hypothetical protein EAM_0367 [Erwinia amylovora ATCC 49946]
MSNSWQSEIPKARVNIQLSLHTGGAQKKVELPLKLMVVGDYSNGAEQRAVSEREPVSVDKNNFNSVLSEF
SPSLDISVENTLAGDGSEENVSLSFGEMKDFGPEQVARQIPQLKAMLAMRNLLRDLKANLLDNVTFRKEL
EKILLDPTLSAELRSELSALAPKNA
 
Nucleotide Sequence: 498 bp     [Download]
>ref|NC_013971.1|:446034-446531 hypothetical protein EAM_0367 [Erwinia amylovora ATCC 49946]
ATGTCTAACTCCTGGCAGTCCGAGATCCCCAAGGCTCGCGTTAACATTCAGTTAAGTCTGCACACGGGTG
GCGCGCAGAAAAAAGTGGAATTACCCCTCAAGTTGATGGTGGTAGGCGATTACAGCAACGGCGCTGAACA
GCGTGCGGTATCTGAGCGTGAACCTGTCAGCGTCGATAAAAACAACTTCAACAGCGTGCTGTCCGAATTC
TCTCCCTCCCTGGATATTTCCGTGGAAAACACGCTGGCGGGTGACGGCAGTGAAGAAAATGTCAGCCTCT
CTTTCGGTGAGATGAAAGACTTCGGGCCGGAGCAGGTAGCCCGCCAGATACCCCAGCTCAAAGCCATGCT
GGCCATGCGCAATCTGCTTCGCGACCTGAAAGCAAACCTGCTGGACAACGTGACCTTCCGCAAGGAGCTG
GAAAAAATCCTGCTTGACCCAACGCTCAGTGCTGAACTGCGCAGCGAGCTGTCTGCCCTGGCACCGAAAA
ACGCCTGA