SecReT6
Protein ID: 292898094
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0368
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]446566..448113 [+]
Producthypothetical protein
NoteTssC
UniProt IDD4IE20
KEGG IDeay:EAM_0368
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-172, Aligned region: 89..511
APG6 [PF04111], Evalue: 0.0052, Aligned region: 41..102
Protein Sequence: 515 a.a.     [Download]
>gi|292898094|ref|YP_003537463.1| hypothetical protein EAM_0368 [Erwinia amylovora ATCC 49946]
MLMSVKNDNAAGGENIVLERAKAGSVYASLFEKINLNPVSKLSALDIWQDNQAMSDATADERLTAGMRVF
LDCLSKAGSKVEKLDKSLIDHHIAELDYQISRQLDAVMHHEAFQRVESLWRGVKSLVDKTDFRQNVKIAL
LDLSKEDLRQDFEDAPEIIQSGLYQHTYTAEYDSPGGEPVAALISAYEFDASAQDVALLRHISNVSAAAH
MPFIGSAGAQFFLKESMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTMPV
RSFNYVEEVKGPDHNKYLWTNASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKI
PSEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSTQKPVRYDTADATANSRINSRLPYILLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDSLQASHPLRDARVVVEDIEDNPGFFRVRLF
AVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1548 bp     [Download]
>ref|NC_013971.1|:446566-448113 hypothetical protein EAM_0368 [Erwinia amylovora ATCC 49946]
ATGCTGATGTCGGTAAAAAATGATAACGCCGCTGGTGGTGAAAACATCGTGCTGGAGCGTGCGAAAGCGG
GCAGCGTGTACGCCTCCCTGTTTGAGAAAATTAACCTGAATCCGGTATCAAAGTTGAGCGCGCTGGATAT
CTGGCAGGATAATCAGGCGATGTCGGATGCAACGGCCGATGAGCGTCTGACCGCCGGCATGCGGGTGTTC
CTGGATTGCCTGAGTAAAGCGGGTTCGAAGGTTGAAAAGCTGGATAAGAGCCTGATTGACCACCATATCG
CGGAGCTGGACTACCAGATTAGCCGCCAGCTGGACGCGGTGATGCATCATGAAGCATTCCAGCGCGTCGA
ATCCCTGTGGCGCGGAGTAAAATCACTGGTAGATAAAACCGATTTCCGTCAGAACGTCAAAATCGCGCTG
CTTGACCTGTCGAAAGAGGATTTGCGTCAAGATTTTGAAGACGCGCCGGAAATTATACAGAGCGGGTTGT
ACCAGCACACGTACACGGCCGAGTACGACAGCCCGGGCGGAGAGCCTGTTGCCGCGCTGATTTCCGCCTA
CGAGTTTGATGCGTCGGCTCAGGACGTGGCGCTGCTGCGTCATATCTCCAACGTTTCTGCCGCTGCGCAT
ATGCCGTTTATCGGTTCGGCCGGAGCGCAATTCTTCCTGAAAGAGTCGATGGAAGAGGTGGCGGCGATCA
AAGACATTGGCAACTACTTCGACCGCGCCGAGTACATCAAATGGAAATCCTTCCGTGATACCGACGACTC
CCGCTATGTCGGCCTGGTAATGCCGCGCGTGCTGGGGCGCTTGCCGTATGGCCCGGACACCATGCCGGTG
CGCAGCTTCAACTACGTGGAGGAAGTGAAAGGCCCGGACCATAACAAATACCTGTGGACTAACGCCTCGT
TTGCTTTTGCGGCCAACATGGTGAAAAGCTTTATCAACAACGGCTGGTGCGTACAAATTCGTGGCCCGCA
GGCCGGTGGCGCAGTGCAGGATCTGCCGATTCATCTGTACGACCTGGGCACCGGCAATCAGGTGAAGATC
CCCTCTGAGGTGATGATCCCGGAAACCCGTGAGTTTGAATTTGCTAACCTCGGTTTTATTCCGCTGTCGT
ACTACAAAAACCGCGACTATGCCTGCTTTTTCTCGGCCAATTCCACGCAAAAGCCGGTGCGGTATGATAC
GGCTGATGCGACGGCCAACAGCCGCATCAACTCGCGTCTGCCGTACATCTTGCTGCTATCGCGCATTGCT
CACTACCTGAAGCTTATTCAGCGCGAAAACATCGGTACGACTAAAGACCGCCGCCTGCTGGAGTTGGAGC
TGAATACGTGGGTGCGTGGGTTGGTGACTGAAATGACCGATCCGGGTGATTCACTTCAGGCATCACATCC
GCTGCGTGATGCCAGAGTGGTGGTGGAAGATATCGAGGACAACCCGGGCTTCTTCCGCGTGAGGCTGTTT
GCAGTACCGCACTTCCAGGTGGAAGGCATGGACGTCAATCTGTCGCTGGTGTCGCAGATGCCAAAAGCCA
AGGCATAA