SecReT6
Protein ID: 292898095
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0369
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]448131..449480 [+]
Producthypothetical protein
NoteTssK
UniProt IDD4IE21
KEGG IDeay:EAM_0369
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.90E-121, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|292898095|ref|YP_003537464.1| hypothetical protein EAM_0369 [Erwinia amylovora ATCC 49946]
MKIYRPLWNEGALLSPQQFQQQSEWESFRSAGISALASPFPWGVETLKFDDPLLASGLIQISPLRLWLED
GSLIDAQCSDLPPVPRELNSAQLAGLDAVTVVIALPLMQQGVNNVQQDAEMSDRPQRYREEWLPVQDAFG
TEEEFMAVARFNYSIRFAHENNASWRTCPVARLIWDGQNGWRQDAAFIPPVALFSASPMLCERLVLLNRQ
LRSRRQRLMAMRRESNERLADFAVADVSLFWLLNALNSHARVLSEYERFPARHPEQVWAELARLAGSLLT
FSLNHDLDAIPGYDHAEPAHTFPPLFELITGLLEASLPSRVIALEMSRPDEQTWKASLHDIRLREEADLY
LSVRSDIPAWQLADKFPALCQAGSPDDVKEIYSAALKGIPLIAVSRVPAALPVRMENQYFALDMESPAAR
EMQDQGVCMFYVPALLGRLELELFAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>ref|NC_013971.1|:448131-449480 hypothetical protein EAM_0369 [Erwinia amylovora ATCC 49946]
ATGAAAATTTATCGTCCATTGTGGAATGAGGGGGCGCTGCTGTCCCCCCAGCAATTCCAGCAGCAGTCGG
AATGGGAGTCTTTTCGCAGTGCGGGGATCTCTGCACTGGCCTCGCCATTTCCGTGGGGAGTGGAAACGCT
AAAGTTTGATGACCCCCTGCTGGCTTCCGGGCTGATCCAGATCTCACCGCTGCGTCTCTGGCTGGAAGAT
GGCTCCCTTATCGATGCGCAATGCAGCGATCTGCCGCCTGTACCACGAGAACTCAATTCCGCTCAGTTGG
CGGGTCTTGATGCGGTCACTGTCGTTATTGCGCTGCCCCTGATGCAGCAAGGTGTGAACAACGTTCAGCA
AGATGCGGAGATGTCAGACAGACCGCAGCGCTATCGCGAAGAGTGGCTACCGGTTCAGGATGCTTTCGGC
ACGGAAGAAGAGTTCATGGCCGTCGCCCGCTTCAATTACTCCATCCGGTTTGCCCATGAAAATAACGCGT
CGTGGCGAACCTGCCCTGTGGCGCGTCTGATTTGGGACGGACAGAACGGATGGCGTCAGGACGCGGCGTT
TATTCCTCCTGTGGCCTTATTCTCCGCCAGCCCGATGCTGTGCGAACGCCTGGTTCTGCTCAATCGCCAG
CTTCGCTCCCGCCGTCAGCGCCTGATGGCTATGCGTCGTGAGAGTAATGAACGTCTGGCTGATTTCGCCG
TTGCCGATGTTTCGCTGTTCTGGTTGCTGAACGCGCTTAATTCCCATGCGCGGGTGCTGTCGGAATACGA
ACGCTTTCCGGCCAGGCACCCGGAGCAGGTGTGGGCAGAGCTTGCCAGGCTGGCGGGCAGCCTGCTGACC
TTTTCTCTCAACCACGATCTGGACGCTATTCCCGGCTATGACCACGCTGAACCGGCCCATACTTTCCCGC
CGCTGTTTGAACTGATAACCGGTTTGCTGGAAGCCAGCCTGCCGTCGAGGGTGATCGCACTTGAGATGTC
GCGTCCGGATGAGCAGACGTGGAAAGCCTCTTTACACGATATCCGTTTGCGCGAAGAGGCCGACCTGTAC
CTCTCCGTGCGCTCAGATATTCCAGCCTGGCAGCTCGCCGATAAGTTTCCTGCACTTTGTCAGGCCGGTT
CACCCGATGACGTGAAAGAAATCTACAGCGCCGCACTCAAGGGGATCCCACTTATTGCCGTCAGCCGCGT
ACCGGCAGCATTGCCGGTACGCATGGAAAACCAGTACTTCGCGCTGGATATGGAAAGCCCCGCTGCCCGC
GAGATGCAGGATCAGGGCGTGTGCATGTTCTATGTGCCTGCTTTGCTGGGCCGGCTGGAGCTTGAGCTGT
TTGCGGTGCTGCGATCATGA