SecReT6
Protein ID: 292898096
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0370
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]449477..450154 [+]
Productmembrane protein
NoteTssL
UniProt IDD4IE22
KEGG IDeay:EAM_0370
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.50E-43, Aligned region: 7..212
Protein Sequence: 225 a.a.     [Download]
>gi|292898096|ref|YP_003537465.1| membrane protein [Erwinia amylovora ATCC 49946]
MRQEIDIDQLMTETWLTVTLLRRGATTLDGAALYDNCTKQVENAREALQRAGYDEASIGHITYAQCALLD
EAVMSRKSVENAHRLDDSQVAWRKAPLQARFFGSLHAGEALWERIAEVLRQPAPDNAVLTCYHRVIALGF
QGLYSVETVSQEQRGEVIKALSERVPMPDADLSLVIHRTAKHRYSMVRSVWFWVIMTAVLTAGVWWGGHL
WLQALLSAQIPELRR
 
Nucleotide Sequence: 678 bp     [Download]
>ref|NC_013971.1|:449477-450154 membrane protein [Erwinia amylovora ATCC 49946]
ATGAGACAAGAAATCGATATCGACCAACTGATGACGGAAACCTGGCTGACCGTCACCTTACTGAGGCGGG
GGGCCACCACGCTGGACGGCGCAGCGCTTTATGATAACTGCACGAAGCAGGTTGAAAACGCCCGTGAGGC
GCTGCAACGCGCAGGGTACGACGAAGCCAGCATTGGGCATATCACCTACGCCCAGTGCGCCCTGCTGGAT
GAAGCGGTGATGAGTCGAAAATCCGTGGAGAATGCACACCGGCTGGATGACAGCCAGGTGGCCTGGCGTA
AAGCGCCGCTTCAGGCGCGTTTTTTTGGCTCCCTGCATGCCGGTGAGGCGCTTTGGGAGCGTATTGCGGA
AGTGCTGCGGCAGCCTGCACCGGATAACGCGGTGCTGACCTGTTATCACCGCGTCATTGCGTTGGGCTTC
CAGGGGCTGTACAGCGTGGAGACCGTCAGCCAGGAACAGCGGGGAGAGGTGATTAAGGCACTTTCTGAAC
GGGTGCCGATGCCTGATGCGGATCTGTCTCTGGTGATCCACCGGACCGCTAAACACCGCTACAGCATGGT
GCGCTCAGTTTGGTTCTGGGTAATCATGACGGCCGTACTGACGGCGGGAGTCTGGTGGGGCGGGCACCTT
TGGCTCCAGGCGCTGCTATCTGCGCAAATACCGGAGCTGCGACGTTAA