SecReT6
Protein ID: 292898099
SecReT6 ID388
T6SS typei2
Gene symbolclpB
Locus tagEAM_0373
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]452504..455164 [+]
ProductATPase/chaperone
NoteTssH
UniProt IDD4IE25
KEGG IDeay:EAM_0373
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.60E-40, Aligned region: 236..277
AAA_2 [PF07724], Evalue: 3.60E-40, Aligned region: 610..774
AAA [PF00004], Evalue: 9.10E-19, Aligned region: 238..369
AAA [PF00004], Evalue: 9.10E-19, Aligned region: 615..738
AAA_16 [PF13191], Evalue: 8.30E-15, Aligned region: 215..258
AAA_16 [PF13191], Evalue: 8.30E-15, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 8.30E-15, Aligned region: 483..483
AAA_16 [PF13191], Evalue: 8.30E-15, Aligned region: 583..658
AAA_16 [PF13191], Evalue: 8.30E-15, Aligned region: 678..708
AAA_16 [PF13191], Evalue: 8.30E-15, Aligned region: 753..806
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 614..732
ClpB_D2-small [PF10431], Evalue: 4.00E-12, Aligned region: 383..407
ClpB_D2-small [PF10431], Evalue: 4.00E-12, Aligned region: 781..853
AAA_22 [PF13401], Evalue: 3.50E-09, Aligned region: 62..151
AAA_22 [PF13401], Evalue: 3.50E-09, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 3.50E-09, Aligned region: 613..635
AAA_25 [PF13481], Evalue: 1.40E-07, Aligned region: 238..262
AAA_25 [PF13481], Evalue: 1.40E-07, Aligned region: 291..326
AAA_25 [PF13481], Evalue: 1.40E-07, Aligned region: 362..384
AAA_25 [PF13481], Evalue: 1.40E-07, Aligned region: 612..646
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 216..261
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 611..626
Arch_ATPase [PF01637], Evalue: 1.70E-06, Aligned region: 684..696
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 238..367
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 613..652
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 238..332
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 614..637
IstB_IS21 [PF01695], Evalue: 2.60E-05, Aligned region: 96..153
IstB_IS21 [PF01695], Evalue: 2.60E-05, Aligned region: 232..258
IstB_IS21 [PF01695], Evalue: 2.60E-05, Aligned region: 614..632
AAA_19 [PF13245], Evalue: 2.90E-05, Aligned region: 235..258
AAA_19 [PF13245], Evalue: 2.90E-05, Aligned region: 612..636
Sigma54_activat [PF00158], Evalue: 5.90E-05, Aligned region: 219..252
Sigma54_activat [PF00158], Evalue: 5.90E-05, Aligned region: 614..731
Zeta_toxin [PF06414], Evalue: 6.20E-05, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 6.20E-05, Aligned region: 463..508
Zeta_toxin [PF06414], Evalue: 6.20E-05, Aligned region: 613..654
AAA_14 [PF13173], Evalue: 7.40E-05, Aligned region: 238..328
AAA_14 [PF13173], Evalue: 7.40E-05, Aligned region: 613..696
SRP54 [PF00448], Evalue: 0.001, Aligned region: 238..260
SRP54 [PF00448], Evalue: 0.001, Aligned region: 613..660
DUF258 [PF03193], Evalue: 0.0011, Aligned region: 220..256
DUF258 [PF03193], Evalue: 0.0011, Aligned region: 614..626
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 238..265
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 615..638
RNA_helicase [PF00910], Evalue: 0.0033, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0033, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0033, Aligned region: 712..732
AAA_33 [PF13671], Evalue: 0.0044, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.0044, Aligned region: 452..497
AAA_33 [PF13671], Evalue: 0.0044, Aligned region: 613..632
AAA_24 [PF13479], Evalue: 0.0062, Aligned region: 175..212
AAA_24 [PF13479], Evalue: 0.0062, Aligned region: 238..253
AAA_24 [PF13479], Evalue: 0.0062, Aligned region: 614..636
AAA_29 [PF13555], Evalue: 0.0077, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 0.0077, Aligned region: 612..625
Protein Sequence: 886 a.a.     [Download]
>gi|292898099|ref|YP_003537468.1| ATPase/chaperone [Erwinia amylovora ATCC 49946]
MEHRSAILLRRLNPYCAKALEAAATLCQTRAHAQITIEHWLLKLLEMGEGDITVLARRYEWDMDALWQSL
LSHLDALPRSVYSRPPLSDDMQALMEAAWLVASLEDNNQTIRSVNLLEALMTRPKLLRCDDLWPLFSLSE
SQISRLKPLLDAQSDERPERQQQERLGQMPFTLGEETAQDSGISGNHLSDALQAALDKFTLDVTAKARAG
QIDPIFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALIEGLALRISEGNVPDSLKNVSLRTLDMGLL
QAGAGVKGEFEQRLKNVIDAVQNSPTPVLLFIDEAHTLIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAVLERRFQRVKVDEPDEQTACLMLRGLKSRYARHHGVHITDEAVKAAVSLSRRYIPGRQ
LPDKAVDLLDTASARVRMSLDTLPEELTRLKAQITALDMEAQALREDTALRNHPHGDRLAQIEQQTNALG
DQLAQFDMQYLAEKALTRQLLEVRQDSNRQEDSIGLQQQLSDLQGSAPLMSIDVDVRTVATVIADWTGVP
LTSLLKDEQTDLLQLESHLGQRVVGQEHALIDLARRLRAAKTGLTCGNGPLGVFLLVGPSGVGKTETALS
LADCLFGGEKSLITINMSEYQEAHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHTDVM
NLFYQVFDRGFMRDGEGREIDFRNSVILMTANLGSDHLIQLLDERPEATHGDLHALLRPILRDHFQPALL
ARFQTLIYRPLDASALRTVVKMKLAQVAKRLNTHYGLHCTIGESLYDILIAACLLPDTGARNIDSLLNQQ
ILPVLSQQLLSLMAAKQKPSSLQLSWDDAEGIVLAFDSVSAKSDKT
 
Nucleotide Sequence: 2661 bp     [Download]
>ref|NC_013971.1|:452504-455164 ATPase/chaperone [Erwinia amylovora ATCC 49946]
ATGGAACACCGGTCAGCCATCTTACTTCGTCGCTTAAACCCGTACTGTGCAAAAGCGCTGGAAGCCGCCG
CCACCCTGTGTCAGACGCGAGCGCACGCACAAATCACCATTGAGCACTGGCTACTCAAGCTGCTGGAAAT
GGGCGAGGGTGACATCACCGTGCTGGCTCGCCGCTACGAATGGGATATGGATGCACTGTGGCAGAGTTTG
CTGTCACATCTTGATGCTTTGCCGCGCTCGGTATATTCCCGCCCACCGCTCTCCGATGACATGCAGGCGC
TGATGGAAGCCGCCTGGCTGGTGGCGTCATTAGAAGATAATAACCAGACTATCCGCAGTGTAAACCTGCT
GGAGGCGCTGATGACCAGGCCGAAGCTGCTGCGCTGCGACGATCTGTGGCCGCTGTTCAGCCTCAGTGAG
TCACAAATCAGCCGCCTGAAACCGCTGCTGGATGCGCAATCCGATGAACGCCCTGAACGGCAACAGCAGG
AACGTCTGGGTCAAATGCCCTTCACGCTGGGTGAAGAAACGGCACAGGATAGCGGTATTTCTGGCAATCA
TTTAAGCGATGCGCTTCAGGCCGCGCTGGACAAATTCACGCTGGACGTGACCGCTAAAGCCAGAGCCGGG
CAGATTGATCCGATATTTGGCCGCGACAACGAAATCCGCCAGATGGTGGATATTCTCTCCCGTCGTCGCA
AAAACAACCCCATCTTAGTCGGCGAACCGGGCGTCGGGAAAACGGCGCTAATCGAAGGCCTGGCGCTCCG
CATCAGCGAGGGTAACGTGCCGGACAGCCTGAAAAACGTCAGTCTGCGCACGCTGGATATGGGGCTGCTG
CAGGCCGGGGCGGGTGTGAAGGGCGAATTCGAACAGCGTCTTAAAAACGTCATCGACGCGGTGCAGAACT
CGCCGACGCCGGTTTTACTGTTTATCGACGAAGCGCACACCCTGATCGGTGCCGGCAATCAGGCGGGGGG
AGCGGATGCGGCCAACCTGCTTAAACCCGCTCTCGCCCGTGGCGAACTGCGTACTATTGCGGCGACCACC
TGGTCCGAGTACAAGCAGTATTTTGAGCGCGATGCCGTCCTGGAACGCCGCTTTCAGAGGGTTAAAGTCG
ATGAGCCTGATGAGCAGACGGCCTGCCTGATGCTACGTGGCCTGAAGTCCCGCTACGCCCGGCACCACGG
TGTGCACATTACCGATGAAGCGGTGAAAGCCGCCGTCAGCCTGTCGCGCCGCTACATCCCCGGTCGTCAG
TTGCCGGACAAAGCCGTTGACCTGCTGGATACCGCCTCCGCCCGGGTGCGCATGAGCCTTGATACCCTGC
CGGAAGAGTTGACCCGCCTGAAAGCGCAAATCACCGCGCTGGATATGGAAGCGCAGGCGCTGCGTGAAGA
TACCGCGCTAAGAAACCATCCCCACGGCGACCGCCTGGCACAGATTGAGCAACAGACGAATGCGCTTGGC
GACCAGCTTGCGCAATTTGACATGCAGTATCTTGCCGAAAAAGCCCTGACCCGGCAACTGCTGGAAGTGC
GCCAGGACAGCAACCGTCAGGAAGATAGTATTGGACTGCAACAGCAACTGAGCGATTTGCAGGGCAGTGC
ACCCTTGATGAGCATTGATGTGGACGTGCGCACCGTGGCCACCGTAATTGCCGACTGGACCGGCGTTCCA
CTGACCAGCCTGCTGAAGGATGAACAGACCGACCTGCTGCAGCTGGAAAGCCATCTGGGTCAGCGCGTCG
TCGGGCAAGAGCACGCCCTTATCGACCTGGCCCGGCGGCTGCGCGCCGCCAAAACCGGACTCACTTGCGG
AAACGGCCCGCTGGGCGTGTTCCTGCTGGTGGGGCCGAGCGGGGTGGGTAAAACCGAGACGGCGCTTTCA
TTGGCCGATTGCCTGTTTGGCGGAGAAAAGTCCCTCATCACCATCAACATGTCTGAGTACCAGGAAGCGC
ATACCGTTTCCCAGCTCAAAGGTTCGCCTCCTGGCTACGTCGGTTACGGTCAGGGCGGCATTCTCACCGA
GGCGGTGCGCAAGCGCCCGTACAGCGTGGTGCTGCTTGATGAAGTGGAAAAAGCCCATACGGACGTGATG
AACCTGTTTTATCAGGTTTTCGACCGTGGCTTTATGCGGGACGGGGAAGGGCGCGAAATCGACTTTCGCA
ACAGCGTCATTCTGATGACGGCCAATCTGGGCAGTGACCATCTGATTCAGCTGCTGGACGAACGGCCGGA
AGCGACCCACGGCGATTTGCATGCGCTGCTGCGCCCGATATTGCGCGACCACTTCCAGCCCGCCCTGCTG
GCCCGTTTCCAGACGCTGATCTACCGTCCGCTGGACGCCAGTGCACTGCGCACCGTTGTCAAAATGAAAC
TGGCCCAGGTCGCCAAACGTCTGAACACACATTATGGCCTGCATTGCACCATCGGGGAGAGCCTCTACGA
CATCCTGATCGCTGCCTGCCTGCTGCCGGATACCGGCGCACGCAACATCGACAGCCTGCTCAATCAGCAG
ATTTTACCGGTACTGAGTCAGCAGTTATTAAGCCTGATGGCGGCTAAGCAGAAGCCGTCCTCCCTACAGC
TTTCCTGGGATGATGCAGAAGGCATTGTACTGGCGTTTGATTCGGTATCGGCGAAGTCAGATAAAACCTA
A