SecReT6
Protein ID: 292898106
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0380
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]463556..465163 [+]
Producthypothetical protein
NoteTssA
UniProt IDD4IE32
KEGG IDeay:EAM_0380
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.80E-18, Aligned region: 71..129
ImpA-rel_N [PF06812], Evalue: 8.80E-18, Aligned region: 164..180
ImpA-rel_N [PF06812], Evalue: 8.80E-18, Aligned region: 302..314
Protein Sequence: 535 a.a.     [Download]
>gi|292898106|ref|YP_003537475.1| hypothetical protein EAM_0380 [Erwinia amylovora ATCC 49946]
MSSPEALLSACTTDKKEQQHLLSRASEALSLWDNWLRPLGPEQGAGDDPAYDDNFQLMREEINKLSGTDA
QLLCELAEKCLCESAKDIRVVTWYIQARLSREGEKGLAEGLLLLAAMLSHYGKRCHPQRPNARKAALEWL
NSGKVLDALSLWPEADRNDAGLTAGAVTLLASAIADWPDSEKPSFAGLCIALENRLARSGGMEALIPQNS
GAREVGRAFVLSDSPLLSAVKSGRDLLDQARLLARWLGEQPQGWLASHRLMKTVRWDTVDQVPPLDNSGR
TRLVPPKAEYRAQLKRFYLQKNWTELVEQASQMFCEGVNHFWLDLQWYLWQGLSHGGQPWETWADSVLLD
LRLFLQRLPGLDLLAWSDGTPFADEVTQGWIAGKVNEDERVFHDDAATVANSQADDVLSLEAEAMEKGDS
ESPEAAIAWLQIRPGAETPRQRWLMRLLMARVAEQYGRNDMALHLLGELTASAPRLTLVDWEPALLFEVQ
ARRLKLLRMKAGRSAAEKALMMPEMDTLLAGLIAIDPARAMVLCG
 
Nucleotide Sequence: 1608 bp     [Download]
>ref|NC_013971.1|:463556-465163 hypothetical protein EAM_0380 [Erwinia amylovora ATCC 49946]
ATGAGTTCGCCAGAAGCGTTGTTATCAGCCTGCACCACAGACAAGAAAGAGCAGCAGCATCTTCTCTCGC
GGGCATCTGAAGCCCTGTCACTTTGGGATAACTGGTTACGTCCTCTCGGCCCGGAACAGGGAGCCGGAGA
CGATCCGGCCTATGATGATAACTTCCAACTGATGCGCGAAGAAATCAACAAACTTTCCGGTACCGATGCG
CAACTGCTGTGTGAGCTGGCGGAAAAATGCCTGTGCGAGAGCGCCAAAGATATCCGGGTAGTGACCTGGT
ACATTCAGGCCCGTCTGAGCCGTGAGGGCGAGAAAGGGCTGGCGGAGGGCTTATTGCTGTTGGCTGCCAT
GCTGTCCCATTACGGAAAACGGTGCCATCCACAGCGCCCCAACGCCCGCAAGGCTGCGCTGGAGTGGCTG
AACAGTGGCAAAGTGCTCGACGCACTGTCGCTATGGCCGGAGGCGGACCGCAACGACGCGGGCCTGACTG
CCGGAGCCGTTACTCTGCTTGCTTCCGCTATTGCTGACTGGCCGGATAGCGAAAAACCATCCTTTGCAGG
ACTCTGTATCGCACTGGAAAATCGCCTGGCACGTTCAGGAGGCATGGAGGCATTGATTCCCCAAAACAGT
GGTGCCCGGGAAGTGGGTCGCGCATTCGTCCTTTCCGATTCACCACTGTTGTCTGCCGTGAAGTCCGGTC
GCGACTTGCTTGACCAGGCCAGGTTGCTTGCCCGCTGGCTGGGCGAGCAACCCCAGGGCTGGCTCGCCTC
GCACCGACTAATGAAAACCGTGCGCTGGGACACGGTCGATCAGGTCCCGCCGCTGGACAACAGTGGACGG
ACCCGGCTGGTGCCGCCCAAAGCGGAATACCGTGCGCAGTTAAAGCGCTTTTATCTGCAGAAAAACTGGA
CTGAGCTGGTGGAGCAGGCCAGCCAGATGTTCTGCGAAGGGGTTAACCACTTCTGGCTCGATCTCCAGTG
GTATCTCTGGCAGGGACTCAGTCACGGCGGTCAGCCGTGGGAAACCTGGGCTGATTCTGTCCTGCTGGAT
TTGCGACTGTTCCTGCAACGTCTGCCCGGGCTGGATCTGCTTGCCTGGAGCGATGGCACCCCGTTTGCCG
ATGAGGTTACACAGGGTTGGATAGCCGGGAAGGTGAATGAGGATGAGAGGGTATTCCATGATGACGCTGC
CACGGTAGCCAACAGCCAGGCGGATGATGTGCTGTCGCTGGAGGCGGAGGCGATGGAAAAGGGTGACAGC
GAGAGCCCGGAAGCCGCGATCGCCTGGCTTCAGATCCGACCTGGCGCGGAGACACCACGCCAACGCTGGC
TGATGCGCCTGCTGATGGCCCGGGTGGCCGAACAGTACGGTCGCAACGACATGGCCTTGCATCTGCTGGG
TGAACTGACCGCCAGCGCCCCGCGGCTGACGTTGGTTGACTGGGAGCCTGCCCTGTTGTTTGAAGTGCAG
GCCCGTCGCCTGAAGCTGTTACGCATGAAAGCCGGCCGCAGCGCGGCCGAAAAAGCCCTTATGATGCCCG
AAATGGACACCTTGCTGGCTGGCCTTATCGCTATCGACCCTGCCCGGGCCATGGTGCTCTGTGGCTAA