SecReT6
Protein ID: 292898107
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0381
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]465318..467087 [+]
Producthypothetical protein
NoteTssF
UniProt IDD4IE33
KEGG IDeay:EAM_0381
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-178, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|292898107|ref|YP_003537476.1| hypothetical protein EAM_0381 [Erwinia amylovora ATCC 49946]
MDDLTLRYFDAEMRYLREAGKEFAHAHPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLAIVEFSPDWHRLRQSECLSEGFSVLSRPVGPHQTACQYRTTRDLLLQPLH
LADARLHTETDGRSAIRLRFECTEKVDWSKAGADKVAIFLNAESPLSSALHLALTRRVHAMYARHVATGT
ERRRFDGWCKPMGFDDHDGLWQKADSAFSGYQLLLEYFSFRPKFMFIELRGLETVGLNSASRWFEIDIVL
TEAWSSDLPFTSENFRLHCAPVINLFTLEADPLTLNPLDNEYLLRPLRLQDGHTEIYSVDNIHGAVKHGK
HPYVPFTSFRHRGGMMRHDAPERYYHTRVKRGVSGLYNTWLILGGRSFELDQLSEKPESLSMRITATNGQ
LPRKALESTLLDRVVKAGKVPVKVLNVSAPTLPLYPPANDRFHWRVMSHLGSNFLSMMDNPEVLRGTLAL
YDWSNDEINRRRLEAIVAVKHTLIRRFEKGFMLRGVDIEVTLNADNFAGEGDVNLFGEMLHRFFGLYADI
HLFNQLTLLLQPTGKRLRWNEIHSQHVPG
 
Nucleotide Sequence: 1770 bp     [Download]
>ref|NC_013971.1|:465318-467087 hypothetical protein EAM_0381 [Erwinia amylovora ATCC 49946]
ATGGATGATTTAACGCTGCGCTACTTTGACGCAGAAATGCGCTACTTGCGGGAGGCCGGTAAAGAGTTTG
CCCACGCTCACCCGGACCGGGCGGCAATGCTTAACCTGGATAAACCCGGCGCGCGCGACCCGTACGTCGA
ACGCCTGTTTGAAGGTTTCGCCTTTCTGATGGGGCGTCTGCGTGAAAAACTTGATGATGACCTGCCAGAG
TTGACTGAAGGCTTAGTCAGCCTGTTGTGGCCGCATTACATGCGCACCATTCCGTCGCTGGCCATCGTGG
AGTTTTCCCCCGACTGGCACCGTCTTCGCCAGTCTGAGTGTCTGTCGGAGGGTTTTTCTGTCCTGTCCCG
TCCCGTGGGGCCGCATCAAACTGCCTGCCAGTACCGGACCACCCGTGACCTCCTGCTGCAGCCGCTGCAT
CTGGCGGATGCGCGCCTGCACACCGAAACCGATGGTCGCTCTGCAATCCGTTTGCGTTTTGAGTGCACGG
AGAAAGTGGACTGGAGCAAAGCCGGGGCAGACAAGGTCGCCATTTTTCTCAATGCCGAAAGCCCGCTCAG
CTCGGCACTGCATCTGGCATTGACCCGCCGGGTTCACGCCATGTATGCCCGACATGTAGCTACCGGTACT
GAACGCCGCAGGTTTGATGGCTGGTGTAAACCCATGGGTTTTGATGACCATGACGGGCTGTGGCAGAAGG
CCGATTCCGCCTTCAGCGGTTATCAGCTGTTGCTGGAATACTTCAGTTTCCGGCCGAAGTTTATGTTTAT
TGAGCTGCGCGGTCTTGAGACCGTTGGGCTTAACTCTGCCAGCCGCTGGTTTGAAATCGATATCGTTCTG
ACGGAGGCCTGGTCATCCGACTTACCGTTTACAAGCGAGAACTTCCGCCTGCACTGTGCGCCGGTGATTA
ACCTCTTTACCCTCGAAGCCGATCCGCTGACGCTTAACCCGCTGGACAATGAATATCTGCTGCGCCCGCT
GCGTCTGCAGGACGGCCATACCGAAATCTACAGCGTGGATAACATCCACGGCGCGGTGAAACACGGCAAG
CACCCGTACGTACCTTTTACCAGCTTCCGCCACCGGGGCGGCATGATGCGCCATGATGCGCCCGAACGCT
ACTATCATACCCGTGTAAAGCGCGGTGTATCCGGTCTGTATAACACCTGGCTTATTCTTGGCGGGCGCTC
TTTCGAGCTTGACCAGCTCTCTGAGAAACCTGAGTCGCTCTCCATGCGTATCACCGCAACCAACGGCCAG
CTACCGCGTAAGGCGCTGGAAAGCACCCTGCTGGACCGGGTGGTCAAGGCAGGCAAAGTACCGGTTAAGG
TGCTGAACGTCTCGGCACCAACGCTGCCGCTGTACCCGCCTGCAAACGATCGTTTCCACTGGCGGGTAAT
GAGCCACCTTGGATCGAATTTCCTTAGCATGATGGACAATCCGGAAGTGCTGCGCGGAACCCTGGCGCTG
TACGACTGGAGCAATGATGAGATTAACCGCCGGCGTCTGGAGGCGATCGTTGCGGTAAAACACACGCTCA
TTCGCCGCTTTGAGAAAGGCTTTATGCTGCGCGGCGTGGATATCGAGGTCACGCTGAATGCGGATAACTT
CGCGGGCGAGGGGGATGTGAATCTCTTCGGCGAGATGCTGCATCGCTTCTTCGGGCTGTATGCGGATATT
CACCTATTCAATCAGCTTACGCTGTTGCTGCAACCGACAGGGAAACGACTGCGATGGAACGAAATTCACA
GCCAGCACGTACCGGGCTGA