SecReT6
Protein ID: 292898108
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0382
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]467051..468133 [+]
Producthypothetical protein
NoteTssG
UniProt IDD4IE34
KEGG IDeay:EAM_0382
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.70E-81, Aligned region: 18..319
Protein Sequence: 360 a.a.     [Download]
>gi|292898108|ref|YP_003537477.1| hypothetical protein EAM_0382 [Erwinia amylovora ATCC 49946]
MERNSQPARTGLTLALNKDIWRANFYRFCQLLEQENPDSPRLGATSHPGSDPVRFRPWPGMGFPVSTLKT
VETDEDHPELPPTVRTTFLGMYGVDSPLPSSYLDDIAQRREGHEAVSSFLDIFSHRITTQYYRIWRKYAY
PATFEAGGRDATSQCLLGLVGLGIPGTAEQVTTPISRFLALLGTMRLPTRNAEGIRALVRLLAPDTRATL
IQPDSVRVHINNRSGLGAGNRVRLSQRATLGKTAKEACSRVLVVLETENPQEAEGWLPGGHMHTDLLALM
RVYLGYRSAARLRLTVPVRLLPEPRLGNSRRIQLGRTGLAGLKDGKLSIDRQTLTVSLGCYEGLQCASLP
PAEDGHYRFK
 
Nucleotide Sequence: 1083 bp     [Download]
>ref|NC_013971.1|:467051-468133 hypothetical protein EAM_0382 [Erwinia amylovora ATCC 49946]
ATGGAACGAAATTCACAGCCAGCACGTACCGGGCTGACGTTAGCCCTCAATAAAGACATCTGGCGGGCCA
ACTTTTACCGCTTTTGCCAGCTGCTGGAGCAGGAAAACCCGGATTCACCCAGGCTGGGGGCGACCAGCCA
TCCGGGCAGCGATCCGGTACGGTTCAGGCCGTGGCCGGGGATGGGTTTTCCGGTCAGTACCCTGAAAACC
GTGGAGACCGACGAAGACCATCCCGAACTTCCTCCGACCGTACGCACCACTTTTTTGGGCATGTACGGCG
TGGATTCACCGCTACCCAGTTCGTATCTGGATGATATTGCACAGCGGCGGGAAGGACATGAGGCAGTTAG
CTCATTTCTGGATATCTTCAGCCACCGTATCACCACCCAGTATTACCGTATCTGGCGCAAATATGCCTAC
CCGGCCACTTTTGAAGCTGGCGGCCGTGACGCCACCTCACAGTGTCTGCTGGGGCTGGTGGGGCTGGGTA
TTCCGGGCACGGCTGAACAAGTGACCACCCCCATCTCGCGTTTTCTGGCGTTGCTGGGCACCATGCGTTT
ACCTACCCGCAACGCCGAGGGGATACGCGCCCTGGTCCGTCTGCTGGCGCCTGATACGCGGGCCACCCTC
ATCCAGCCCGATTCGGTCAGGGTCCATATCAACAACCGCAGCGGTCTGGGGGCGGGGAACCGCGTCCGGC
TGTCGCAGCGGGCCACGCTGGGTAAGACCGCTAAAGAAGCCTGCAGCAGGGTGCTGGTGGTGCTGGAGAC
TGAAAATCCGCAGGAGGCAGAAGGCTGGTTACCGGGGGGTCACATGCACACCGACCTGCTGGCGCTGATG
CGCGTCTATCTGGGATATCGCAGCGCTGCCCGGCTGCGCCTTACCGTACCGGTGCGGTTGCTGCCCGAAC
CCCGACTGGGTAACAGCAGACGCATACAGCTGGGGCGAACTGGGCTGGCCGGTCTTAAAGACGGCAAACT
CAGTATTGATCGGCAAACCCTGACGGTCAGCCTGGGCTGCTATGAGGGGCTGCAATGTGCTTCATTGCCT
CCGGCTGAAGATGGCCATTACCGCTTTAAATAA