SecReT6
Protein ID: 292898109
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0383
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]468159..468683 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD4IE35
KEGG IDeay:EAM_0383
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-33, Aligned region: 15..164
Protein Sequence: 174 a.a.     [Download]
>gi|292898109|ref|YP_003537478.1| hypothetical protein EAM_0383 [Erwinia amylovora ATCC 49946]
MTRVNRRRALTLMACCLLAGCGLTRAVTDGTVNMTKSIFYKKIRMLHLDFTPRTAMNADGAQIPLATMVR
IYQLKDRKAVDAADYRTMLRNADAALKDDLVVSKELLVMPKGSMTLNMPMDENAQFVAVIGLFNRPDLQD
NRWRLVLTRDDLDPDKPRTAELGDGWLSLVPLKE
 
Nucleotide Sequence: 525 bp     [Download]
>ref|NC_013971.1|:468159-468683 hypothetical protein EAM_0383 [Erwinia amylovora ATCC 49946]
ATGACAAGAGTAAACCGGAGGCGGGCGCTAACGCTCATGGCCTGCTGCCTGCTTGCAGGCTGCGGCCTGA
CCCGTGCCGTCACCGACGGCACGGTAAACATGACGAAGTCCATCTTCTATAAAAAAATCAGAATGCTGCA
TCTGGATTTTACCCCGCGTACCGCGATGAACGCCGATGGTGCTCAGATCCCGCTGGCAACCATGGTGAGG
ATCTACCAGCTGAAGGACCGTAAGGCGGTTGATGCAGCCGATTACCGGACTATGCTGCGCAACGCCGACG
CGGCGCTGAAAGATGACCTTGTGGTGTCAAAAGAGCTGCTGGTGATGCCCAAAGGCAGCATGACGCTGAA
CATGCCGATGGATGAGAACGCGCAGTTTGTTGCCGTGATCGGGTTATTTAACCGTCCCGATCTGCAAGAC
AACCGCTGGCGGCTGGTACTGACCCGTGACGATCTTGACCCGGATAAACCGCGCACCGCTGAACTGGGCG
ATGGCTGGCTCAGCCTTGTGCCGCTAAAGGAGTGA

Protein ID: 292898116
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0390
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]474387..474785 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD4IE42
KEGG IDeay:EAM_0390
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.00E-31, Aligned region: 2..130
Protein Sequence: 132 a.a.     [Download]
>gi|292898116|ref|YP_003537485.1| hypothetical protein EAM_0390 [Erwinia amylovora ATCC 49946]
MTKSIFYKKIRTLHLDFTPRTAMNADGAQIPLATMVRIYQLKDRKAVDAADYRTMLRNADAALKDDLVVS
KELLVMPKGSMTLNMPMDENAQFVAVIGLFNRPDLQDNRWRLVLTRDDPDPDKPRTAELGDG
 
Nucleotide Sequence: 399 bp     [Download]
>ref|NC_013971.1|:474387-474785 hypothetical protein EAM_0390 [Erwinia amylovora ATCC 49946]
ATGACGAAGTCCATCTTCTATAAAAAAATCAGAACGCTGCATCTGGATTTTACCCCGCGTACCGCGATGA
ACGCCGATGGTGCTCAGATCCCGCTGGCAACCATGGTGAGGATCTACCAGCTGAAGGACCGCAAGGCGGT
TGATGCAGCCGATTACCGGACAATGCTGCGCAACGCCGACGCGGCGCTGAAAGATGACCTTGTGGTGTCA
AAAGAGCTGCTGGTGATGCCCAAAGGCAGCATGACGCTGAACATGCCGATGGATGAGAACGCGCAGTTTG
TTGCCGTGATCGGGTTATTTAACCGTCCCGATCTGCAAGACAACCGCTGGCGGCTGGTACTGACCCGTGA
CGATCCTGACCCGGATAAACCGCGCACCGCTGAACTGGGCGATGGCTGA