SecReT6
Protein ID: 292898110
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0384
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]468688..471000 [+]
Producthypothetical protein
NoteTssI
UniProt IDD4IE36
KEGG IDeay:EAM_0384
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 33..341
Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 479..517
Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 559..591
DUF2345 [PF10106], Evalue: 5.50E-32, Aligned region: 601..729
T6SS_Vgr [PF13296], Evalue: 1.30E-28, Aligned region: 470..574
T6SS_Vgr [PF13296], Evalue: 1.30E-28, Aligned region: 606..625
Phage_base_V [PF04717], Evalue: 4.90E-11, Aligned region: 390..464
Protein Sequence: 770 a.a.     [Download]
>gi|292898110|ref|YP_003537479.1| hypothetical protein EAM_0384 [Erwinia amylovora ATCC 49946]
MNNWLALFDGQSRYVLEIHDSPVHPDVLRFYGREALSEPFTWDIEFTTEQANIAPGQVLMKYASLRMRSG
KNVHGIITRLEWRSTTADQSHYTIRLSSRLALLSHSRKCAVYQNQSVPEVVAQVLRQHGLAGADFAFRLV
RTYPPRELITRWRETDLQFIRRLLSEVGIYWRTEMDSTRELDVYIFADSQLNYQFDVRLPYSEPSGLFDG
AEESVWDVRSWHNVVTGSVVTRDHNYRTAATPLNATVSVRNDAVTSGEHYRYAAPYQEAGDDSDPEPETE
SGAFYARMHHERELNQSARIHLFSNAPHLTPGQVLEPQGDVINALKEGVIITLATYRASRDTRLHVSVWG
MPYSERYSFRPVEIPRPAIHGTLPARIESGEKNDIYAHPDEQGRYRVRLDFDREGTGPGYLWLRMAKPYS
GETSGWHMPLVDGTGVAIAWGNGDIDLPYIAHALHDSEHPDPVNRDNPTRNILCTAANNQLRMEDKRGEE
HIALATEYGKTGLNSGHLVDAQGMPRGAGTELRTDERGTIRAGKGLLLSADNQPKAQGEVPDRAAALKET
GRLQQQLRQLEMAAEQAQALKADIDSQMRMLAQRLKPLHKIIHFTAPQGMALTSGEDTQLAATENLAMNA
GGDISAGVTGNLAALAGERLGLYARTGPLSLKAGEGPVDMQAQNGNMRLFAEQKLTIASEEDILFAGKKR
ITLTGGGGSYLRLEAGKVEYGTTGTYRRRVKRTMVAGAANLPLPFRNKGLCLSCLMDAAMNGTPVVLRGN
 
Nucleotide Sequence: 2313 bp     [Download]
>ref|NC_013971.1|:468688-471000 hypothetical protein EAM_0384 [Erwinia amylovora ATCC 49946]
ATGAATAACTGGCTGGCGCTTTTTGACGGGCAGAGCCGCTACGTACTGGAGATTCATGACAGCCCGGTAC
ACCCTGATGTGCTGCGCTTTTATGGGCGCGAGGCGTTAAGCGAACCGTTCACATGGGATATTGAATTCAC
CACGGAACAGGCAAATATTGCCCCCGGACAGGTGCTGATGAAGTACGCGTCCTTGCGGATGCGCAGCGGC
AAAAATGTCCACGGCATCATTACCCGCCTGGAATGGCGGTCAACGACAGCTGACCAGTCGCACTACACAA
TCAGGCTCAGCTCGCGCCTGGCGCTGCTGTCGCACAGCCGGAAATGCGCCGTATACCAGAATCAGTCGGT
ACCGGAGGTGGTGGCACAGGTGCTGCGCCAGCACGGACTGGCAGGGGCTGATTTTGCATTTCGTCTGGTG
CGCACCTACCCGCCGCGTGAGCTGATAACCCGGTGGCGGGAGACGGATTTGCAGTTTATCCGGCGGCTGT
TGTCGGAAGTGGGGATTTACTGGCGCACGGAGATGGACAGCACGCGGGAGCTGGACGTGTACATCTTTGC
CGACAGCCAGCTTAACTACCAGTTTGACGTGCGCCTGCCGTACAGCGAGCCGTCTGGGTTGTTCGACGGT
GCGGAAGAATCGGTGTGGGACGTGCGCAGCTGGCATAACGTGGTCACCGGCAGCGTCGTTACCCGCGACC
ACAACTACCGCACGGCCGCCACGCCGCTGAATGCGACCGTCAGCGTGCGCAACGATGCGGTGACCAGCGG
TGAACACTATCGTTACGCCGCCCCGTACCAAGAAGCCGGGGACGACAGCGACCCGGAGCCTGAAACGGAA
AGCGGGGCGTTTTACGCCCGCATGCATCACGAGCGCGAACTGAATCAGTCCGCGCGCATTCACCTGTTCA
GTAACGCCCCGCACCTGACGCCGGGTCAGGTGCTGGAGCCGCAGGGCGATGTGATAAATGCGCTGAAAGA
GGGGGTTATCATCACGCTTGCCACTTACCGCGCCTCGCGTGATACCCGCCTGCACGTATCGGTATGGGGA
ATGCCATACAGCGAGCGCTACAGCTTCCGTCCGGTGGAAATCCCGCGTCCGGCCATCCACGGCACGCTGC
CGGCGCGCATTGAGAGCGGGGAAAAGAACGACATTTATGCGCACCCGGATGAGCAGGGCCGCTACCGGGT
GAGGCTGGATTTTGACCGCGAAGGTACGGGCCCGGGTTATCTGTGGCTGCGCATGGCGAAACCCTACTCC
GGAGAGACCTCCGGCTGGCATATGCCGCTTGTCGACGGCACCGGAGTGGCGATTGCCTGGGGCAACGGCG
ACATTGACCTGCCGTATATCGCCCATGCGCTGCACGACTCAGAGCACCCGGACCCCGTAAACCGCGATAA
CCCCACCCGCAATATTCTGTGCACTGCGGCTAACAACCAGCTGCGGATGGAGGACAAACGCGGCGAGGAG
CATATCGCACTCGCCACGGAATACGGCAAAACCGGGCTCAATAGCGGCCATCTGGTGGATGCACAGGGCA
TGCCGCGCGGTGCCGGTACGGAACTGCGTACCGATGAACGGGGCACGATACGTGCCGGAAAAGGGCTGTT
GCTCAGTGCGGATAACCAGCCGAAAGCCCAGGGCGAAGTGCCGGACAGGGCCGCCGCGCTGAAGGAAACC
GGCCGGCTTCAGCAGCAACTCAGACAGCTTGAAATGGCGGCAGAGCAGGCACAGGCGCTGAAGGCGGATA
TCGACAGCCAGATGCGGATGTTAGCGCAACGGCTGAAGCCGCTGCATAAAATCATCCATTTTACCGCCCC
GCAGGGGATGGCACTGACCAGCGGCGAAGATACGCAGCTGGCTGCCACGGAGAACTTGGCGATGAATGCC
GGGGGCGACATCAGCGCGGGCGTGACGGGCAACCTGGCGGCGCTTGCCGGAGAAAGGCTGGGGCTGTATG
CCCGGACGGGGCCCCTGAGTCTGAAAGCGGGTGAAGGTCCGGTGGATATGCAGGCGCAGAACGGCAATAT
GCGGCTGTTTGCGGAGCAGAAGCTGACCATTGCGTCAGAAGAGGACATCCTGTTTGCCGGCAAGAAGCGC
ATCACGCTGACAGGCGGAGGCGGCAGTTATCTGCGGCTTGAGGCGGGGAAAGTGGAGTACGGCACTACCG
GAACGTACAGGCGGCGGGTGAAAAGGACGATGGTGGCTGGGGCGGCGAATCTGCCACTTCCGTTCAGGAA
TAAGGGGTTATGCCTGAGTTGTCTGATGGATGCAGCGATGAATGGAACACCTGTAGTACTGAGGGGGAAT
TAA