SecReT6
Protein ID: 292898117
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0391
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]474817..475401 [+]
Producthypothetical protein
NoteTssI
UniProt IDD4IE43
KEGG IDeay:EAM_0391
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|292898117|ref|YP_003537486.1| hypothetical protein EAM_0391 [Erwinia amylovora ATCC 49946]
MNNWLALFDGQSRYVLEIHDSPVHPDVLRFYGREALSEPFTWDIEFTTEQANLAPGQVLMKFVDKLEIME
NGEFKSCYLNFSDLTAIELEKKSQFNYIKIGSTLWEKATDDLDDVYGALDSFIIKVAFTDLDVTRDSSGF
VRLEIKELGLYVRDTYDFINDGDDQLLGYWGSNGVIKPGVISELMKKKIHRQRK
 
Nucleotide Sequence: 585 bp     [Download]
>ref|NC_013971.1|:474817-475401 hypothetical protein EAM_0391 [Erwinia amylovora ATCC 49946]
ATGAATAACTGGCTGGCGCTTTTTGACGGGCAGAGCCGCTACGTACTGGAGATTCATGACAGCCCGGTAC
ACCCTGATGTGCTGCGCTTTTATGGGCGCGAGGCGCTAAGCGAACCGTTCACATGGGATATTGAATTTAC
CACGGAACAGGCAAATCTTGCCCCCGGACAGGTGCTGATGAAGTTCGTAGATAAGTTAGAGATTATGGAA
AATGGTGAATTTAAGAGTTGCTACCTAAATTTTAGTGACCTGACAGCTATCGAGTTGGAAAAGAAAAGTC
AGTTTAATTATATAAAGATTGGTAGTACGTTGTGGGAAAAAGCAACAGATGATCTGGATGACGTGTATGG
GGCACTTGATTCTTTCATAATCAAAGTCGCGTTTACCGATCTTGATGTCACCAGAGATAGCAGCGGGTTC
GTGAGGCTAGAGATTAAGGAACTTGGTTTATACGTCAGAGATACTTATGATTTCATTAATGATGGTGATG
ATCAGTTGCTGGGATATTGGGGGAGTAATGGGGTGATTAAACCCGGGGTAATAAGTGAGTTAATGAAAAA
AAAGATACATCGACAAAGAAAATGA