SecReT6
Protein ID: 292898120
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0395
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]476226..477116 [+]
Producthypothetical protein
NoteTssI
UniProt IDD4IE46
KEGG IDeay:EAM_0395
PDB IDNA
Domain hit(s) vs Pfam T6SS_Vgr [PF13296], Evalue: 4.60E-28, Aligned region: 48..152
T6SS_Vgr [PF13296], Evalue: 4.60E-28, Aligned region: 184..197
DUF2345 [PF10106], Evalue: 5.00E-24, Aligned region: 131..154
DUF2345 [PF10106], Evalue: 5.00E-24, Aligned region: 179..283
Sarcoglycan_1 [PF04790], Evalue: 0.00053, Aligned region: 11..34
Sarcoglycan_1 [PF04790], Evalue: 0.00053, Aligned region: 148..208
Sarcoglycan_1 [PF04790], Evalue: 0.00053, Aligned region: 218..271
Protein Sequence: 296 a.a.     [Download]
>gi|292898120|ref|YP_003537489.1| hypothetical protein EAM_0395 [Erwinia amylovora ATCC 49946]
MLSQQCKTITGIRGKAGITVKGESGPYIAHALHDSERPDPVKRDNPTRNILCTAANNQLRMEDKRGEEPI
ALATEYGKTGLNSGHLVDAQGMPRGAGTELRTDERGTIRAGKGLLLSADNQPKALGEVPDRAAALKETGR
LQQQLRQLEMAAEQAQALKADIDSQMRMLAQRLKPLHKIIHFTAPQGMALTSGEDMQLAATENVAMNAGG
DISAGVTGNMAALAGERLGLYARTGPLSLKAGEGPVDMQAQNGNMRLFAEQKLTIASEEDILFAGKKRIT
LIVHFLFVRLFKIDKY
 
Nucleotide Sequence: 891 bp     [Download]
>ref|NC_013971.1|:476226-477116 hypothetical protein EAM_0395 [Erwinia amylovora ATCC 49946]
TTGTTATCTCAACAGTGCAAAACAATTACAGGGATCAGAGGAAAAGCAGGAATCACTGTAAAAGGTGAGT
CAGGACCGTATATCGCCCATGCGCTGCACGACTCAGAGCGCCCGGACCCCGTAAAACGCGATAACCCCAC
CCGCAACATTCTGTGCACTGCGGCTAACAACCAGCTGCGGATGGAGGACAAACGCGGCGAGGAGCCTATC
GCACTCGCCACGGAATACGGCAAAACCGGGCTCAATAGCGGCCATCTGGTGGATGCACAGGGCATGCCGC
GCGGTGCCGGTACGGAACTGCGTACCGATGAACGGGGCACGATACGTGCCGGAAAAGGGCTGTTGCTCAG
TGCGGATAACCAGCCGAAAGCCCTGGGCGAAGTGCCGGACAGGGCCGCCGCGCTGAAGGAAACCGGCCGG
CTTCAGCAGCAACTCAGACAGCTTGAAATGGCGGCAGAGCAGGCACAGGCGCTGAAGGCGGATATCGACA
GCCAGATGCGGATGTTAGCGCAACGGCTGAAGCCGCTGCATAAAATCATCCATTTTACCGCCCCGCAGGG
GATGGCACTGACCAGCGGCGAAGATATGCAGCTGGCTGCCACGGAGAACGTGGCGATGAATGCCGGGGGC
GACATCAGCGCGGGCGTGACGGGCAACATGGCGGCGCTTGCCGGAGAAAGGCTGGGGCTGTATGCCCGGA
CAGGGCCCCTGAGTCTGAAAGCGGGTGAAGGTCCGGTGGATATGCAGGCGCAGAACGGCAATATGCGGCT
GTTTGCGGAGCAGAAGCTGACCATTGCGTCAGAAGAGGACATCCTGTTTGCCGGCAAGAAGCGCATCACG
CTGATTGTTCATTTTTTATTTGTACGGTTATTTAAAATTGATAAATACTAA