SecReT6
Protein ID: 292898123
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0398
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]477848..478300 [+]
Producthypothetical protein
NoteTssE
UniProt IDD4IE49
KEGG IDeay:EAM_0398
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-16, Aligned region: 28..115
Protein Sequence: 150 a.a.     [Download]
>gi|292898123|ref|YP_003537492.1| hypothetical protein EAM_0398 [Erwinia amylovora ATCC 49946]
MESKSPSLYEILTGNFIGDLPLELISEEDQVILSVLDQIQRIMNSRAGTLSHLPDYGLPDMTQILQGMPG
TAQQLMRILSAVLLKYEPRLKSIKVSMLEQTIPGELRYAIDAELKGMGLVRYGTEFMPEGRVLIRHLKQQ
QYLSLRTSVY
 
Nucleotide Sequence: 453 bp     [Download]
>ref|NC_013971.1|:477848-478300 hypothetical protein EAM_0398 [Erwinia amylovora ATCC 49946]
ATGGAAAGTAAATCTCCCTCTCTCTATGAAATTCTTACCGGAAACTTTATCGGTGATTTACCACTTGAAC
TCATTAGCGAAGAAGATCAGGTTATTTTATCCGTACTGGATCAGATTCAACGGATAATGAACTCTCGTGC
CGGTACCCTATCCCATCTGCCAGATTACGGTTTGCCGGATATGACCCAAATTTTGCAAGGAATGCCGGGC
ACTGCCCAGCAATTAATGAGAATACTTTCCGCCGTACTGCTCAAATATGAACCCCGTTTGAAGAGCATTA
AGGTTTCGATGCTTGAGCAGACAATTCCCGGCGAACTGCGCTACGCCATCGATGCCGAACTCAAGGGCAT
GGGTCTGGTGCGCTACGGTACGGAATTTATGCCGGAAGGGCGGGTACTCATCAGGCATTTAAAGCAACAG
CAATATCTTTCCTTGCGGACATCAGTGTACTGA