SecReT6
Protein ID: 292898124
SecReT6 ID388
T6SS typei2
Gene symbol-
Locus tagEAM_0399
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]478345..479745 [+]
Producthypothetical protein
NoteTssA
UniProt IDD4IE50
KEGG IDeay:EAM_0399
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 9.20E-45, Aligned region: 111..131
DUF3702 [PF12486], Evalue: 9.20E-45, Aligned region: 315..452
ImpA-rel_N [PF06812], Evalue: 9.70E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 9.70E-20, Aligned region: 361..382
Protein Sequence: 466 a.a.     [Download]
>gi|292898124|ref|YP_003537493.1| hypothetical protein EAM_0399 [Erwinia amylovora ATCC 49946]
MTHFSERYLKTGADPRTLPDYAALRDELSKLAHPARPDVNWHYAEKLCLALFGHNGVELQTAAWYTLCRT
QLAGLFGLNEGLAILDALISHQWSGLWPQPVHARMEILSSLSQRIQQLMRRLPLNYSDLSQLYRAEQLLS
SMGSALQRLELKHLCQFDPLRTLMHNSAVRLENSDVASGHTADNQPGFKLSIDATPKAAISVGGLSGIPG
SAKSESPNTVKWVCVAQPAYQPNVGVVTEMPSSTKPWKPFATGMVTMLVISATTVWGWNAFHRPDPLQTQ
LAASLAPLPSVLSSEQLEGLRQQAPLPETIIKNTRQQLARLEQLPPGWTSQYGHQLVQQALMMWPEQAKG
LAREWQQQLNAAALPTENLNGWHEGMSQLQQLSHKLNGLDGQKGKYMTVSELKSVVYSATQAFNRSIPAE
EQLRRYAVNPSDIQRRQVETVLQQLQKRYALFRLGQQKETTILATE
 
Nucleotide Sequence: 1401 bp     [Download]
>ref|NC_013971.1|:478345-479745 hypothetical protein EAM_0399 [Erwinia amylovora ATCC 49946]
ATGACGCACTTTTCTGAACGTTATCTGAAAACTGGCGCCGACCCGCGCACGCTGCCGGATTATGCCGCTC
TGCGCGATGAATTGTCTAAACTGGCTCACCCGGCTCGGCCCGATGTTAACTGGCACTATGCGGAAAAACT
CTGTCTCGCGTTGTTCGGGCACAACGGCGTGGAGCTTCAGACTGCAGCCTGGTACACGCTTTGCCGCACT
CAGCTTGCCGGGCTGTTCGGCTTAAATGAAGGGCTGGCAATCCTTGATGCACTGATTTCTCACCAGTGGT
CAGGATTGTGGCCGCAGCCGGTGCATGCACGGATGGAGATTCTCAGCAGTCTTAGCCAGCGCATTCAGCA
ACTGATGCGCAGGCTACCTTTAAACTACAGCGACCTCAGCCAGCTTTATCGGGCGGAGCAGCTACTCAGT
AGTATGGGCTCAGCGTTACAGCGTTTGGAACTAAAGCATCTATGCCAGTTTGACCCCCTGCGTACCTTAA
TGCATAACAGTGCCGTTCGGCTGGAAAACAGTGATGTTGCTTCAGGTCATACTGCAGACAATCAGCCGGG
TTTCAAGCTGTCAATCGATGCAACGCCAAAAGCGGCAATATCCGTTGGTGGTCTGTCCGGCATACCCGGG
TCAGCCAAAAGCGAATCGCCAAACACGGTGAAATGGGTCTGTGTGGCGCAGCCAGCATATCAGCCAAATG
TCGGGGTTGTGACGGAAATGCCTTCATCAACTAAACCCTGGAAACCTTTTGCTACAGGAATGGTGACCAT
GTTGGTGATAAGCGCCACAACGGTATGGGGCTGGAACGCTTTTCACCGACCGGATCCGCTACAGACGCAG
CTTGCTGCATCACTGGCCCCTTTACCTTCGGTGCTCTCTTCCGAGCAACTGGAGGGACTGCGTCAGCAAG
CTCCTCTGCCGGAAACGATAATCAAAAATACCCGGCAGCAGCTCGCCCGCCTTGAGCAATTGCCTCCGGG
CTGGACCTCCCAATATGGCCACCAACTGGTACAACAGGCTTTAATGATGTGGCCAGAGCAGGCAAAAGGA
CTGGCGAGGGAGTGGCAACAGCAGCTTAACGCCGCAGCGCTGCCGACAGAAAACCTGAATGGCTGGCACG
AAGGGATGTCGCAACTGCAGCAACTGAGTCATAAGCTGAATGGGCTGGACGGGCAAAAAGGCAAATACAT
GACGGTCAGCGAACTGAAGTCGGTGGTGTATTCAGCCACTCAGGCGTTTAACCGCTCCATACCCGCAGAG
GAACAGCTGCGACGGTACGCTGTCAACCCTTCTGATATTCAGCGGCGGCAGGTGGAAACAGTCCTGCAGC
AACTCCAGAAGCGCTATGCTTTGTTCAGGCTTGGACAGCAAAAAGAAACAACAATATTGGCAACAGAATG
A