SecReT6
Protein ID: 292898294
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0572
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]636187..636699 [+]
Productlipoprotein
NoteTssJ
UniProt IDD4IFS0
KEGG IDeay:EAM_0572
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.30E-29, Aligned region: 20..137
Protein Sequence: 170 a.a.     [Download]
>gi|292898294|ref|YP_003537663.1| lipoprotein [Erwinia amylovora ATCC 49946]
MHRLSIFRLVTQAFLLAAFTLLAGCVSTSRSVPAQYSLVFQAHPQINNSAPLKVRVLLLKSDADLMAADF
YSLQTNPQGVLGQNLLNSEQFFLMPGQTDKKLAGQSSPEARYIGIMAEYQMLDGKKWRISLPVPLPAERH
FYQFWQGDADNLRADIIADINGVRVVNARD
 
Nucleotide Sequence: 513 bp     [Download]
>ref|NC_013971.1|:636187-636699 lipoprotein [Erwinia amylovora ATCC 49946]
ATGCACAGACTTTCGATTTTTCGCCTGGTGACTCAGGCGTTTTTGCTGGCAGCCTTTACCCTGCTGGCAG
GTTGTGTTTCCACTTCACGCAGCGTCCCCGCGCAGTACAGCCTGGTCTTTCAGGCACATCCTCAGATCAA
CAACTCGGCTCCGCTGAAAGTACGGGTGCTGCTGCTGAAGTCGGATGCGGATTTAATGGCGGCCGATTTC
TATTCGCTGCAAACCAATCCGCAGGGCGTGCTGGGGCAAAACCTGTTGAACAGCGAGCAGTTTTTCCTGA
TGCCGGGGCAAACTGACAAAAAACTGGCCGGGCAGAGCAGCCCGGAGGCGCGGTATATCGGCATTATGGC
GGAATATCAAATGCTTGATGGCAAAAAGTGGCGTATTTCACTGCCGGTTCCTCTCCCCGCAGAACGCCAT
TTTTATCAGTTCTGGCAGGGGGATGCGGATAATCTGCGTGCCGACATCATCGCCGATATCAACGGTGTCC
GTGTTGTTAATGCCCGCGATTAG