SecReT6
Protein ID: 292898295
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0573
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]636719..638062 [+]
Producthypothetical protein
NoteTssK
UniProt IDD4IFS1
KEGG IDeay:EAM_0573
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-142, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|292898295|ref|YP_003537664.1| hypothetical protein EAM_0573 [Erwinia amylovora ATCC 49946]
MSKAEKVVWTEGMFLRPHHFQQSENYLQSTLRDWGQAQRPWLWGLHDIEFDESMLRQGKVALLSASGLLP
DGTVFSFRNGQDAPAPLLIPDNLTQGKVVLALPARRGGREEVIFSEAADSLARFISFEREVDDVNAMAVG
QAAVQFGRLRLRLMLESELSAEWTAIGVARISEKRSDHQLRLDASYIPPMLNAINQSQLMEYIGDIHALL
AQRSQQIGQRLQQPGRFNTADMVDFMLLTLINQQLGHISHLKSLPLLHPETLFHGWLTFAAELTSWMPSR
TPDGALPTYQHDDLAGCFSQLLLLLRQGLSQVMEENALQLPLTERSHGLNVATVPESSMVREFGFVLAVR
ANVPADAIQTHFPAQMKVAPVTKIRDLVQLQLPGIMLRAMPAAPPQIPWHAGYNYFQLDKGSELWQEMEK
SGTFALHLAGEFPGLEMEFWAIRSHAV
 
Nucleotide Sequence: 1344 bp     [Download]
>ref|NC_013971.1|:636719-638062 hypothetical protein EAM_0573 [Erwinia amylovora ATCC 49946]
ATGAGCAAGGCAGAAAAAGTAGTCTGGACCGAAGGAATGTTTCTGCGTCCGCATCATTTCCAGCAGAGCG
AAAACTACCTGCAGAGCACGCTGCGCGACTGGGGACAGGCGCAGCGCCCGTGGCTGTGGGGCCTGCACGA
CATTGAATTTGATGAATCGATGCTGCGCCAGGGCAAAGTTGCGCTGCTCTCGGCCAGCGGCCTGCTGCCG
GACGGCACGGTATTTTCCTTCCGCAATGGGCAAGATGCCCCGGCGCCGCTGTTAATCCCTGATAACCTGA
CTCAGGGCAAAGTGGTACTGGCGCTGCCGGCGCGGCGCGGCGGCCGTGAAGAGGTGATCTTCAGCGAAGC
GGCCGATTCGCTGGCGCGCTTTATCAGCTTCGAGCGCGAAGTCGATGATGTTAACGCCATGGCGGTCGGT
CAGGCGGCGGTACAGTTTGGCCGTTTACGTCTGCGGCTGATGCTGGAAAGTGAACTCAGCGCCGAATGGA
CCGCCATCGGCGTGGCGCGTATCAGCGAAAAGCGTAGTGACCACCAACTACGCCTTGACGCCAGCTATAT
TCCACCGATGCTTAATGCCATCAACCAGTCACAGCTGATGGAATACATCGGTGATATCCACGCCCTGCTG
GCGCAGCGCAGCCAGCAGATTGGCCAGCGCTTACAGCAGCCCGGACGCTTTAACACCGCCGATATGGTGG
ACTTTATGCTGCTGACGCTGATTAATCAGCAGCTGGGGCATATCAGCCACCTGAAAAGCTTGCCGCTGCT
CCATCCTGAAACGCTGTTCCACGGCTGGCTCACCTTTGCGGCTGAACTGACCAGCTGGATGCCGTCGCGC
ACCCCGGACGGCGCACTCCCGACCTACCAACACGACGATCTGGCTGGCTGTTTCAGTCAGCTGCTGCTGT
TGCTGCGTCAGGGGCTGTCGCAGGTGATGGAAGAGAATGCGCTTCAGCTGCCGCTGACCGAGCGCTCTCA
CGGGCTGAACGTGGCGACCGTGCCGGAGTCCTCAATGGTGCGCGAGTTTGGCTTTGTGCTGGCGGTGCGT
GCCAACGTGCCGGCCGACGCGATACAAACCCACTTCCCGGCGCAGATGAAGGTGGCTCCGGTGACGAAAA
TCCGCGATCTGGTTCAGCTGCAGCTGCCGGGCATTATGCTGCGCGCCATGCCCGCCGCGCCGCCGCAGAT
CCCGTGGCACGCCGGCTACAACTATTTTCAGCTCGATAAGGGCAGCGAACTGTGGCAGGAAATGGAAAAG
TCCGGCACCTTCGCGCTGCACCTGGCCGGTGAATTCCCGGGGCTGGAGATGGAGTTCTGGGCAATCCGCA
GTCACGCAGTCTGA