SecReT6
Protein ID: 292898296
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0574
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]638080..639321 [+]
Productouter membrane protein
NoteTssL
UniProt IDD4IFS2
KEGG IDeay:EAM_0574
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.50E-71, Aligned region: 21..226
DUF2077 [PF09850], Evalue: 5.50E-71, Aligned region: 353..390
OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|292898296|ref|YP_003537665.1| outer membrane protein [Erwinia amylovora ATCC 49946]
MKQQRHSDAAQTGMNGANGHNPLVAAANPLLNAIPQIRHSVAHPDPAGLRQRLVDEIRQFEMHCQRAGLP
WEVIIGARYCLCTALDEAAALTPWGGRGVWPGNGLLVTFHNETWGGEKFFQLLARLSQTPREQIALLELI
NFCLQLGFEGRYRVMDNGRSQLETIRQRLLQMIRSVRGGYAPPLSAHPEDHPVTRQLWRPLVPLWACSAV
VGFLACLLYILLNWRLGDYTSPVLASIYQTTLPEVSIHNPAPPPPAAVNLKTFLRPEIEQGLVAVRDEAD
RSVVTLKGDGLFTSASTEVRGRYAEVLDRVAAAMNSVSGRILVVGYSDNVPIRSARFASNYELSLARAQS
VSEQLQQHLTQPQRVKAEGRGESNPLAPNNSAGNRARNRRVEITLLVSPGSTRAELNDMAQGN
 
Nucleotide Sequence: 1242 bp     [Download]
>ref|NC_013971.1|:638080-639321 outer membrane protein [Erwinia amylovora ATCC 49946]
ATGAAACAGCAAAGACATTCAGATGCCGCCCAGACGGGTATGAACGGTGCCAACGGTCATAATCCCCTGG
TCGCCGCCGCCAACCCGTTGCTGAACGCCATTCCCCAGATCCGCCATTCGGTCGCCCATCCCGATCCTGC
CGGACTGCGTCAGCGGCTGGTCGACGAAATTCGCCAGTTTGAAATGCATTGCCAGCGTGCCGGGCTGCCC
TGGGAAGTGATTATCGGCGCACGTTACTGCCTGTGTACCGCGCTGGATGAAGCCGCTGCGCTTACTCCCT
GGGGTGGGCGCGGCGTCTGGCCCGGCAACGGGCTGCTGGTTACCTTTCATAATGAAACCTGGGGCGGCGA
AAAATTTTTCCAGCTGCTGGCGCGTCTGTCGCAGACGCCACGTGAGCAGATCGCCCTGCTGGAGCTGATT
AATTTCTGCCTGCAGCTGGGCTTTGAAGGGCGCTACCGGGTGATGGATAACGGGCGCTCCCAGCTGGAGA
CCATCAGGCAGCGGCTGTTGCAGATGATCCGCTCGGTGCGCGGTGGCTATGCACCGCCGCTGTCGGCACA
TCCCGAAGACCATCCGGTAACGCGACAACTGTGGCGGCCGCTGGTGCCGCTGTGGGCCTGTAGCGCCGTG
GTGGGCTTCCTCGCCTGTCTGCTCTATATCCTGCTTAACTGGCGGCTGGGTGATTATACCAGCCCGGTGC
TGGCCTCGATTTACCAGACCACGCTACCGGAAGTGAGCATTCACAATCCGGCTCCGCCGCCGCCGGCAGC
GGTTAATCTGAAAACCTTTCTGCGGCCCGAAATCGAACAGGGGCTGGTGGCGGTGCGCGACGAGGCCGAC
CGCAGCGTAGTGACGCTAAAAGGTGACGGCCTGTTTACCTCCGCCTCCACCGAAGTCCGTGGCCGCTACG
CCGAGGTGCTGGATCGCGTTGCCGCCGCGATGAACAGCGTGAGCGGCCGCATTCTGGTGGTGGGCTACAG
CGATAATGTACCGATCCGCAGCGCGCGCTTTGCCTCCAACTACGAGCTATCTCTGGCGCGTGCGCAGTCG
GTTTCCGAGCAATTGCAGCAGCATCTTACACAGCCGCAGCGGGTGAAAGCGGAAGGGCGGGGCGAAAGCA
ACCCGCTCGCGCCGAACAACAGCGCCGGGAACCGCGCCCGCAACCGACGCGTAGAGATCACCCTGCTGGT
TTCGCCGGGCAGCACCCGGGCCGAGCTGAACGACATGGCGCAAGGAAATTAA