SecReT6
Protein ID: 292898299
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0577
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]643702..644721 [+]
Producthypothetical protein
NoteTssA
UniProt IDD4IFS5
KEGG IDeay:EAM_0577
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.40E-18, Aligned region: 52..111
ImpA-rel_N [PF06812], Evalue: 2.40E-18, Aligned region: 184..201
Protein Sequence: 339 a.a.     [Download]
>gi|292898299|ref|YP_003537668.1| hypothetical protein EAM_0577 [Erwinia amylovora ATCC 49946]
MNLETLLAPVTPERPCGENLEYDADYMAMEQASAGKAEQQFGDTIIPAEPADWNKVERLALGLLGRSKDL
RVMLALTRAWTQLKGLSGYADGLHLIQQALLLYWQPLWPSLEEDGAEDPFYRLNALAALGDKSALTSALR
QAPLLRYATDEISLRDACALLDGSKTECPGYPGGRTRLQDELIRGGLPGIDAVLKISERLLTIRETLTEQ
LGAAALPEMEQLLKTVNTVAAACQATDLSTLIPRVETAASSATPPPAAAPAAQQHADWRSVQLGSRSDAQ
LMLEKVKQYFSQHEPSHPAPLMIERVQRMIELDFMDIIRDLAPDGVHQLETIFGRRDHS
 
Nucleotide Sequence: 1020 bp     [Download]
>ref|NC_013971.1|:643702-644721 hypothetical protein EAM_0577 [Erwinia amylovora ATCC 49946]
ATGAATCTTGAAACGCTGCTGGCCCCGGTCACGCCTGAACGCCCCTGTGGGGAAAATCTCGAATATGACG
CCGACTACATGGCGATGGAACAGGCCAGCGCCGGCAAAGCCGAGCAGCAGTTTGGCGACACCATCATTCC
GGCAGAACCCGCAGACTGGAACAAAGTCGAGCGGCTGGCGCTGGGACTGCTGGGGCGCAGCAAAGATCTG
CGCGTGATGCTGGCGCTGACCCGCGCCTGGACCCAGCTAAAAGGATTGAGCGGTTACGCCGATGGCCTGC
ATCTTATCCAGCAGGCGCTGCTGCTTTACTGGCAGCCGCTGTGGCCGTCACTGGAAGAGGATGGCGCAGA
GGATCCGTTTTACCGTCTTAATGCGCTGGCGGCGCTGGGGGACAAATCGGCGCTGACCAGCGCGCTGCGC
CAGGCGCCGCTGCTGCGCTATGCCACCGATGAAATCAGTCTGCGTGACGCCTGTGCACTGCTCGACGGCA
GCAAAACCGAATGCCCCGGCTACCCCGGCGGCCGCACCCGTTTGCAGGATGAGCTGATAAGGGGGGGGCT
GCCCGGCATTGATGCTGTTCTCAAAATAAGTGAGCGGTTACTGACAATTCGCGAAACGCTGACTGAGCAG
CTGGGCGCTGCGGCGCTGCCGGAAATGGAGCAGCTGCTGAAAACCGTCAATACCGTGGCCGCCGCCTGTC
AGGCCACCGACCTCAGCACCCTGATCCCCCGGGTGGAAACCGCCGCCAGCAGCGCAACGCCGCCGCCAGC
CGCCGCGCCAGCGGCACAGCAGCACGCCGACTGGCGCAGCGTACAGCTTGGCTCGCGCAGCGATGCGCAG
CTGATGCTGGAAAAGGTGAAACAGTACTTCAGCCAGCACGAGCCAAGCCACCCGGCTCCGCTGATGATCG
AGCGGGTACAACGCATGATAGAGCTGGACTTTATGGACATTATCCGCGACCTCGCCCCGGACGGCGTGCA
CCAGCTGGAAACGATTTTCGGGCGTCGCGACCACTCATAG