SecReT6
Protein ID: 292898300
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0578
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]644784..645320 [+]
Producthypothetical protein
NoteTssB
UniProt IDD4IFS6
KEGG IDeay:EAM_0578
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.10E-59, Aligned region: 12..162
Protein Sequence: 178 a.a.     [Download]
>gi|292898300|ref|YP_003537669.1| hypothetical protein EAM_0578 [Erwinia amylovora ATCC 49946]
MAVSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMSDLVGKPLEAQPGIDERKFLEIDVDN
FDERMKALKPRVAFQAENTLTGEGRLNIDLTFNSMEDFSPDAVARKVEPLNQLLDARTQLANLLTYMDGK
NGAEELIGKILQDPTLLQSLSHLPKADDKAADDHGNKE
 
Nucleotide Sequence: 537 bp     [Download]
>ref|NC_013971.1|:644784-645320 hypothetical protein EAM_0578 [Erwinia amylovora ATCC 49946]
ATGGCAGTCAGTAAATCCAGTGGGCAGAAATTCATTGCCCGTAACCGCGCGCCACGCGTGCAGATTGAGT
ACGACGTGGAAATTTATGGCGCGGAACGCAAAATCCAGCTGCCCTTCGTGATGGGCGTGATGTCCGACCT
GGTCGGTAAACCGCTGGAAGCGCAGCCGGGCATCGATGAACGTAAGTTCCTTGAAATCGACGTCGATAAC
TTTGATGAACGCATGAAGGCGCTGAAGCCTCGTGTGGCATTCCAGGCAGAAAACACCCTGACCGGCGAAG
GGCGTCTTAACATCGACCTGACCTTTAACAGCATGGAAGACTTCTCGCCGGATGCGGTAGCGCGCAAGGT
GGAACCGCTTAATCAGCTGCTGGATGCCCGTACCCAGCTGGCTAACCTGCTGACCTACATGGATGGCAAA
AACGGTGCGGAAGAGCTGATCGGCAAAATCCTGCAGGACCCGACGCTGCTGCAATCACTTAGCCATCTGC
CGAAAGCTGACGACAAGGCAGCCGACGACCACGGCAACAAGGAGTAA