SecReT6
Protein ID: 292898301
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0579
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]645324..646823 [+]
Producthypothetical protein
NoteTssC
UniProt IDD4IFS7
KEGG IDeay:EAM_0579
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.70E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|292898301|ref|YP_003537670.1| hypothetical protein EAM_0579 [Erwinia amylovora ATCC 49946]
MSNQFQQSGDLQQQAYSEDAFSALLNKEFRPKSDQARAAVESAVKTLAQQALENTVTVSNDAYRTIQALI
AEIDEKLSLQVNQIIHHEDFQQLEGAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVSWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLSEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHGNYTWTN
AAYAMAANINRSFKDFGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLASAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNDA
 
Nucleotide Sequence: 1500 bp     [Download]
>ref|NC_013971.1|:645324-646823 hypothetical protein EAM_0579 [Erwinia amylovora ATCC 49946]
ATGAGCAATCAATTCCAACAGTCTGGCGACCTGCAACAGCAGGCCTACAGCGAGGACGCGTTCAGCGCGC
TGCTGAATAAAGAGTTCCGCCCGAAAAGCGACCAGGCGCGCGCCGCGGTGGAAAGTGCGGTGAAAACCCT
GGCGCAGCAGGCGCTGGAAAATACCGTTACCGTATCCAACGATGCCTACCGCACCATTCAGGCGCTGATC
GCCGAGATCGACGAGAAGCTCTCCCTGCAGGTCAACCAGATTATCCACCATGAAGACTTCCAGCAGCTGG
AAGGCGCGTGGCGCGGCCTGAGCTATCTGGTCAACAATACCGAAACCGATGAGATGCTGAAAATCCGCTT
TATGAGCATCTCTAAACAGGAGCTGGGCCGCACGCTGAAGCGCTACAAAGGCGTTAGCTGGGATCAAAGC
CCCATCTTCAAGAAGATCTATGAGGAAGAGTACGGCCAGTTTGGCGGCGAACCCTTTGGTTGCCTGGTGG
GCGACTACTACTTTGACCACAGCCCGCAGGACGTGGAGCTGCTTAGCGAAATGGCGCGTATCGGTTCTGC
CGCCCACTGTCCGTTTATCACCGGCACCGCGCCGGGCGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCC
AACCCGCGCGACCTGACCAAAATCTTCCAGAACACCGAATATGCCGCGTGGCGCAGTCTGCGCGAGTCGG
AAGATGCACGCTATCTTGGCCTGGTGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGCATTCGCACCAA
CCCGGTCGACAGCTTCGACTTCGAAGAGCAGACCGACGGCGCTAACCACGGTAACTACACCTGGACCAAC
GCCGCCTACGCGATGGCCGCCAATATCAACCGTTCGTTTAAGGATTTTGGCTGGTGTACCTCAATTCGCG
GCGTCGAGTCCGGCGGGGCGGTGGAAAATCTGCCGTGCCACACCTTCCCGAGCGACGACGGCGGCGTGGA
TATGAAATGCCCGACCGAAATCGCCATCAGCGATCGTCGTGAAGCCGAGCTGGCGAAAAACGGTTTTATG
CCGCTGGTGCACCGCAAAAACTCCGACTTTGCCGCCTTTATCGGCGCACAGTCGCTGCAGAAACCGGCGG
AGTACCACGATGCCGACGCCACTGCCAATGCGCGTCTGGCGGCGCGCCTGCCGTACCTGTTCGCCTGCTG
CCGCTTTGCCCACTATCTGAAGTGCATCGTGCGCGACAAAATTGGCTCCTTCCGCGAGCGCGACGAGATG
GAGCGCTGGCTGAACGACTGGGTGATGAACTACGTTGACGGTGACCCGGCTAACTCCTCACAGGAAACCA
AATCGCGTAAGCCGCTGGCTTCTGCCGAGGTGCAGGTGCAGGAGATTGAAGATAACCCGGGCTACTACGC
CGCCAAGTTCTTTCTGCGTCCGCATTACCAGCTGGAGGGCCTGACCGTATCACTGCGTCTGGTTTCTAAA
CTGCCGTCGCTGAAATCGAACGACGCGTGA