SecReT6
Protein ID: 292898302
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0580
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]647101..647583 [+]
Producthypothetical protein
NoteTssD
UniProt IDD4IFS8
KEGG IDeay:EAM_0580
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|292898302|ref|YP_003537671.1| hypothetical protein EAM_0580 [Erwinia amylovora ATCC 49946]
MAIDMYLKVDGVTGESKDSNHTGWIDVSSFSWGATQPGNMSVGGGGGAGKVNFNDLHINAKIDKAVTALL
KNCASGKHVGKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSDGDDTLGVTYAFQAAKVKQQYWEQST
SGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>ref|NC_013971.1|:647101-647583 hypothetical protein EAM_0580 [Erwinia amylovora ATCC 49946]
ATGGCTATTGATATGTATTTGAAAGTTGACGGTGTAACCGGTGAATCTAAAGATTCTAACCACACCGGTT
GGATCGACGTGTCTTCTTTCTCCTGGGGCGCTACCCAGCCGGGCAATATGTCGGTAGGCGGCGGCGGCGG
TGCCGGTAAAGTGAACTTTAACGATCTGCACATCAATGCAAAAATTGATAAAGCGGTCACCGCGCTGCTG
AAAAACTGCGCCAGCGGTAAGCACGTAGGTAAAGTAGAAGTTTCCGTATGTAAAGCGGGCGGCACTCAGA
TTGAGTACACGCGTATTACTCTGGAAGACGTGCTGGTCACCAACGTGCAGTTCGTTGGTTCCGACGGTGA
CGATACTCTGGGCGTAACCTACGCATTCCAGGCTGCCAAAGTGAAACAGCAGTACTGGGAGCAGAGCACC
TCCGGCGGTAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATTAAAGAGAATAAAGAAGCGTAA