SecReT6
Protein ID: 292898307
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0585
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]649652..651493 [+]
Producthypothetical protein
NoteFha
UniProt IDD4IFT3
KEGG IDeay:EAM_0585
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.40E-08, Aligned region: 27..94
UreE_N [PF02814], Evalue: 0.0023, Aligned region: 30..49
UreE_N [PF02814], Evalue: 0.0023, Aligned region: 78..99
Protein Sequence: 613 a.a.     [Download]
>gi|292898307|ref|YP_003537676.1| hypothetical protein EAM_0585 [Erwinia amylovora ATCC 49946]
MRFTIITTKQGQQPPQGSCDFLPPGGTIGRGADNNLVLPDDDRTISRLQAIVHINATGECHITNRGNVTR
VHLNDIPLERGRQVELQDGDIIGIDDYRLQVSELSAAAQPIIQPVPAPAATRPQPAAAPVAPAPAVKAAP
AAIPSEIWDSLAQEFSISDNLSSRSKAKAQSQANPLTAPAAAERNPADPLAQLAQSSDPLNLERRDRTPD
SLFNQDPLFKQDSIFDDSTPSTLFQPTGAKNSVANGGRENEQDPLALFGTGAAPQVDRDDPLGLMMGSAV
PLTPPEDKPQQISGQPNIPPTPEPVPPVPGEKTPSPADELPLPDCDFSLFGDAKTQQSDEASSPLFDVPP
PAPAAAPSSASGDYGGITLPTPQARARASTPPPKGRLRIDPVANITAHSSDKGDSGEVLEGDLMAALIGG
MGLQDLQPTPRFDHHAMQELGQMLSMFSQGTVALLSSRSILKRGVKAEMTVILDEANNPFKLLPSGKSVL
MQMFGSRMPGFMPPKQSVRDALVDLQAHQLGMIAGIRALIASMLQSFNPQQLEEEARQDGAISRLSLPGS
RKAALWDHFSKRYSETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQIRSEER
 
Nucleotide Sequence: 1842 bp     [Download]
>ref|NC_013971.1|:649652-651493 hypothetical protein EAM_0585 [Erwinia amylovora ATCC 49946]
ATGCGATTTACGATTATAACGACTAAACAGGGCCAGCAGCCGCCGCAGGGCAGCTGCGATTTTCTGCCGC
CCGGCGGCACCATTGGCCGTGGAGCCGATAACAATCTGGTACTGCCGGATGACGACCGCACCATTTCGCG
CCTGCAGGCTATTGTGCATATCAACGCCACGGGCGAATGCCATATCACCAATCGCGGCAATGTCACGCGC
GTCCACCTGAATGATATTCCGCTTGAGCGTGGCCGCCAGGTGGAGCTACAGGATGGCGATATCATCGGCA
TCGATGACTATCGCCTGCAGGTCAGCGAACTTAGCGCAGCGGCGCAGCCGATCATTCAGCCGGTGCCAGC
ACCCGCAGCTACGCGCCCGCAGCCGGCCGCCGCGCCTGTCGCTCCCGCTCCGGCGGTCAAGGCTGCGCCA
GCGGCGATCCCCAGCGAAATCTGGGACAGCCTGGCCCAGGAGTTCTCGATCTCCGATAACCTCTCCAGCC
GCAGCAAAGCGAAAGCGCAAAGCCAGGCTAACCCGCTGACCGCCCCGGCCGCCGCCGAGCGTAATCCGGC
CGATCCGCTGGCCCAGCTGGCGCAAAGCAGCGATCCGTTAAACCTTGAACGCCGCGATCGGACCCCCGAC
AGCCTGTTTAACCAGGATCCGCTGTTTAAACAGGACAGCATCTTTGATGACAGCACCCCCAGCACACTGT
TCCAGCCGACGGGGGCGAAAAACAGCGTTGCCAATGGCGGACGTGAAAACGAGCAGGACCCGCTGGCGCT
GTTCGGCACGGGCGCAGCGCCACAGGTCGACCGCGACGATCCGCTTGGCCTGATGATGGGCAGCGCGGTG
CCGCTGACGCCGCCAGAGGATAAGCCGCAGCAGATCTCCGGGCAGCCGAACATCCCGCCAACGCCAGAAC
CCGTGCCGCCTGTACCCGGCGAAAAAACGCCCTCTCCGGCGGATGAACTGCCGCTGCCGGACTGCGATTT
CAGCCTGTTTGGCGATGCCAAAACCCAGCAGTCAGACGAGGCCAGTTCGCCGCTGTTTGACGTGCCGCCG
CCAGCTCCGGCTGCGGCTCCGTCCTCCGCCAGCGGCGACTATGGTGGTATCACGCTGCCCACGCCGCAGG
CGCGCGCGCGCGCCAGTACGCCACCACCAAAAGGGCGTCTGCGCATTGACCCGGTCGCCAACATCACGGC
GCACAGCAGCGATAAAGGCGACAGCGGTGAAGTGCTGGAGGGCGATCTGATGGCGGCGCTGATCGGCGGG
ATGGGCCTGCAGGATCTGCAACCTACGCCGCGCTTTGACCATCATGCGATGCAGGAACTGGGGCAGATGC
TCAGTATGTTCTCGCAGGGCACGGTGGCGCTGCTCTCTTCGCGATCGATCCTCAAACGCGGCGTAAAAGC
CGAAATGACGGTGATCCTCGACGAGGCCAACAACCCGTTTAAGCTGCTGCCGTCGGGCAAATCGGTACTG
ATGCAGATGTTTGGCAGCCGGATGCCGGGTTTTATGCCGCCGAAGCAGTCGGTGCGCGATGCGCTGGTCG
ATTTGCAGGCGCACCAGCTGGGGATGATCGCCGGCATCCGGGCGCTGATCGCTTCTATGCTGCAATCGTT
TAACCCGCAACAGCTGGAGGAGGAAGCGCGCCAGGATGGTGCCATCTCGCGCCTGTCGCTGCCGGGCAGC
CGCAAGGCCGCGCTGTGGGACCACTTCAGCAAACGCTATAGCGAAACCGCCGGCGAGATTGAAGACGACT
TCCACACCCTGTTTGGCGAAGCTTTCCTTCATGCTTACGATATGGAAGTCAACCAGTACAAAGACTCACA
GATCAGATCGGAAGAAAGATGA