SecReT6
Protein ID: 292898310
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0588
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]653320..654141 [+]
Producthypothetical protein
NoteTagJ
UniProt IDD4IFT6
KEGG IDeay:EAM_0588
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.30E-39, Aligned region: 143..266
TPR_19 [PF14559], Evalue: 0.00091, Aligned region: 8..68
TPR_19 [PF14559], Evalue: 0.00091, Aligned region: 101..125
Protein Sequence: 273 a.a.     [Download]
>gi|292898310|ref|YP_003537679.1| hypothetical protein EAM_0588 [Erwinia amylovora ATCC 49946]
MHSLQYLMDGQSLAETLARLESQIKRQPGDADLRASFVQLLCLAGNWSRAQTQLKSWLALKPQAQPTVTL
LEQAINGERQRAAVFAGEATPRMPGAAWNWAEQLLAALAADAGGDNAEAQRLRAAAIDAAQLNPGQLTHQ
GEQHAFAWLADGDGRLGPVCELIANGQYSWLPFGAISEMRFQAPVSVTDLVWRHTLVRLVDGSEQVCQIP
VRYPFGEQADDRYRLATLTEWQPLAGDDQQFSGHGQKCWFSADGEFPLLGMETLAFSDAEPAL
 
Nucleotide Sequence: 822 bp     [Download]
>ref|NC_013971.1|:653320-654141 hypothetical protein EAM_0588 [Erwinia amylovora ATCC 49946]
ATGCACTCTCTACAATATCTGATGGACGGCCAGTCGCTGGCCGAAACCCTGGCCCGGCTGGAAAGCCAGA
TTAAGCGCCAGCCCGGCGATGCCGATTTACGTGCCAGCTTCGTCCAGCTGCTGTGCCTGGCGGGCAACTG
GAGCCGGGCGCAGACGCAGCTGAAATCCTGGCTGGCGTTGAAGCCGCAGGCACAGCCGACGGTCACGCTG
CTGGAGCAGGCAATTAACGGTGAACGCCAGCGGGCGGCGGTATTCGCCGGTGAAGCGACGCCACGGATGC
CGGGCGCGGCCTGGAACTGGGCAGAGCAACTGCTGGCCGCGCTGGCGGCCGATGCCGGGGGTGACAATGC
CGAGGCGCAACGGCTGCGCGCTGCCGCTATAGATGCGGCGCAGCTCAATCCCGGGCAGTTGACGCACCAG
GGCGAGCAGCACGCTTTTGCCTGGCTGGCCGACGGTGACGGACGGCTCGGCCCCGTCTGCGAACTGATCG
CCAACGGCCAGTACAGCTGGCTGCCGTTCGGCGCCATCAGCGAAATGCGCTTCCAGGCTCCGGTCAGCGT
CACCGATCTGGTGTGGCGGCATACGCTGGTCAGGCTGGTGGACGGCAGCGAACAGGTGTGCCAGATCCCG
GTACGCTATCCGTTTGGCGAACAGGCCGACGACCGCTACCGTCTGGCCACGCTGACCGAATGGCAGCCGC
TGGCGGGCGACGACCAGCAGTTCAGCGGCCACGGTCAGAAATGCTGGTTCAGCGCCGATGGCGAATTCCC
GCTGCTGGGCATGGAGACGCTGGCGTTTAGCGATGCAGAGCCAGCGTTATGA