SecReT6
Protein ID: 292898311
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0589
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]654138..654704 [+]
Producthypothetical protein
NoteTssE
UniProt IDD4IFT7
KEGG IDeay:EAM_0589
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.70E-19, Aligned region: 57..167
Protein Sequence: 188 a.a.     [Download]
>gi|292898311|ref|YP_003537680.1| hypothetical protein EAM_0589 [Erwinia amylovora ATCC 49946]
MSQHSNEGHKLLHGGYRQRRQQEGLNVRDKMQPSLLDRLTDNAPDNPREAAHSTLISHSALRRNVLRDLQ
WLFNTINNEAQQDLSPFPHVQRSTLNFGISPLAGQRMSDIEWLDIQRKLSAAILNFEPRILPAGLQVRCV
SDTRSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFALRDIG
 
Nucleotide Sequence: 567 bp     [Download]
>ref|NC_013971.1|:654138-654704 hypothetical protein EAM_0589 [Erwinia amylovora ATCC 49946]
ATGAGCCAGCACAGCAACGAGGGGCATAAGCTGCTGCACGGCGGTTACCGCCAGCGCCGCCAGCAGGAAG
GGCTGAACGTGCGCGACAAAATGCAGCCATCGCTGCTCGACCGCTTAACCGATAACGCGCCGGATAACCC
GCGTGAAGCGGCGCACAGCACCCTGATTTCACACAGCGCGCTGCGGCGTAACGTGCTGCGCGACCTGCAA
TGGTTGTTTAACACCATTAACAACGAAGCGCAGCAGGATCTGTCACCGTTTCCCCATGTGCAACGCTCGA
CGCTGAACTTCGGCATATCGCCGCTGGCGGGGCAGCGCATGTCGGATATTGAATGGCTGGATATCCAGCG
CAAGCTAAGCGCGGCGATCCTTAACTTCGAACCGCGCATTCTGCCCGCCGGGTTACAGGTGCGCTGCGTG
TCGGACACCCGCTCGCTTGACCTGCACAACGTGCTGTCGATAGAGATCAAAGGCCGTCTGTGGTGCGTGC
CGTACCCGCTGGAATTTCTGTTTCGTACCGATGTGGATCTGGAAAACGGCCACTTTGCGCTGCGCGATAT
CGGTTAA