SecReT6
Protein ID: 292898312
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0590
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]654723..656597 [+]
Producthypothetical protein
NoteTssF
UniProt IDD4IFT8
KEGG IDeay:EAM_0590
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.80E-209, Aligned region: 6..624
Protein Sequence: 624 a.a.     [Download]
>gi|292898312|ref|YP_003537681.1| hypothetical protein EAM_0590 [Erwinia amylovora ATCC 49946]
MDSKQLDYYNRELAYLREMGAEFAGRYPKVAGRLAMRGDEVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPNYLSPTPSMAIAELQPDSRKGDISNGFLVPRGTMMDSQALKQNGVTCSYSTAHDVMLQP
VRIKSVELGGIPANVPLGDLGLSQRGAVSALRIRIACDESVTLAHLNFDSLMFFLSGPDMQALQLLELVM
QHYVGGYCQSVGSNPQRTLLGDNALRQEGFAADQALLPNDLRNFDGYRLLQEYFAFPARFQFISIGQLRP
LLQACDAQAREFDIVLLLDSTNPALERVIDHSHLALHCTPVINLFPKVAQRQKLSDSVHEYHLVVDNIRP
LDYEIFSVQKLYASGERQREEQQFRPFWSTFSDDGGNYGAYFSLRREQRTLSEHAQRFGTRTGYVGSEVF
LSLVDEHNSPWHEDLRYLTAEVMCTSRDLPLLLLQQQGQFVMPDSIPVRQLTLRKGPTPPRPALAEGKIA
WRLVSHLQMNYLSLMDGDNDQGAAALRQMLGLYANLAEAAAARQIDGIRHCQLKPVFRRVPEPGPIVFAR
GIGIELEVDEQAFSGSSPWLLGSVLERVFSRLVAINTFTEMTLTSQQRGEVGYWAPRMGKRTLI
 
Nucleotide Sequence: 1875 bp     [Download]
>ref|NC_013971.1|:654723-656597 hypothetical protein EAM_0590 [Erwinia amylovora ATCC 49946]
ATGGACAGTAAGCAGCTCGACTATTACAACCGTGAACTGGCGTATCTGCGCGAAATGGGCGCGGAGTTTG
CCGGGCGTTATCCGAAGGTGGCAGGCCGTCTTGCCATGCGCGGCGACGAGGTCGCCGACCCCTACGTCGA
GCGGCTGATGGAGGGCTTTGCCTTTCTCACCTCCCGCGTGCAGCTGAAAATGGACGCCGAGTTTCCGCGC
TTCTCCCAGCGCCTGCTGGAGATGATTGCGCCGAACTACCTGTCACCAACGCCGTCGATGGCGATTGCCG
AACTGCAGCCGGACAGCCGCAAAGGGGATATCAGCAACGGTTTTCTGGTGCCGCGCGGCACCATGATGGA
CAGCCAGGCGCTGAAGCAGAACGGCGTCACCTGCAGCTACAGCACCGCCCACGATGTGATGCTGCAACCG
GTACGCATCAAAAGCGTGGAACTGGGCGGTATTCCGGCCAATGTCCCACTGGGCGATCTGGGGTTAAGCC
AGCGCGGTGCGGTAAGCGCTCTGCGCATCCGCATCGCCTGTGATGAAAGCGTCACGCTGGCGCATCTTAA
CTTCGACAGCCTGATGTTCTTCCTTAGCGGGCCGGATATGCAGGCGCTGCAGCTGCTGGAGCTGGTAATG
CAGCACTACGTGGGCGGCTACTGCCAGAGCGTGGGCAGCAACCCGCAGCGCACGCTGCTGGGCGATAACG
CGCTCCGGCAGGAAGGATTTGCCGCCGATCAGGCGCTGCTGCCGAACGATCTGCGCAATTTCGATGGTTA
TCGTCTGTTGCAGGAATACTTCGCCTTCCCGGCGCGTTTCCAGTTTATCAGCATCGGTCAGCTGCGCCCG
CTGTTACAGGCATGCGATGCACAGGCGCGTGAATTCGATATCGTACTGCTGCTGGACAGCACCAACCCGG
CGCTGGAGCGGGTCATCGACCACAGCCATCTGGCGCTGCACTGCACCCCGGTAATCAACCTGTTTCCGAA
GGTGGCGCAGCGCCAGAAGCTCAGCGACAGCGTGCACGAATATCATCTGGTGGTGGATAACATCCGCCCG
CTGGACTACGAAATTTTCTCGGTGCAGAAGCTGTATGCCAGCGGCGAACGCCAGCGCGAGGAGCAGCAGT
TCCGCCCGTTCTGGAGCACCTTCAGCGATGATGGCGGCAACTACGGGGCTTACTTCTCGCTACGGCGCGA
ACAGCGCACGCTGTCCGAACATGCGCAACGCTTCGGCACGCGCACCGGCTATGTCGGTTCGGAAGTATTT
CTGTCGCTGGTTGACGAGCACAACTCGCCGTGGCATGAGGATCTGCGCTATCTCACCGCCGAGGTGATGT
GTACCAGCCGCGATCTGCCGCTGCTGCTGCTGCAACAGCAGGGGCAGTTTGTGATGCCTGATTCGATCCC
GGTGCGCCAGCTGACGCTGCGTAAAGGGCCGACGCCACCGCGTCCGGCGCTGGCGGAGGGGAAAATCGCC
TGGCGGCTGGTCAGTCATTTGCAAATGAACTACCTCAGCCTGATGGACGGTGATAATGACCAGGGGGCGG
CGGCGCTGCGCCAGATGCTTGGGCTGTATGCCAACCTGGCCGAAGCCGCAGCGGCACGCCAGATCGACGG
CATCCGCCACTGCCAGCTGAAACCGGTGTTCCGGCGCGTACCGGAGCCAGGCCCGATTGTCTTTGCCCGT
GGCATCGGCATTGAGCTGGAGGTGGACGAGCAGGCATTTTCCGGCAGCAGCCCGTGGCTGCTTGGCAGCG
TGCTGGAGCGGGTATTCTCGCGGCTGGTGGCGATCAACACCTTCACCGAAATGACGCTGACCAGCCAGCA
GCGCGGCGAGGTCGGCTACTGGGCGCCGCGCATGGGCAAAAGGACGCTGATATGA