SecReT6
Protein ID: 292898313
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0591
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]656594..657658 [+]
Producthypothetical protein
NoteTssG
UniProt IDD4IFT9
KEGG IDeay:EAM_0591
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-109, Aligned region: 28..332
Protein Sequence: 354 a.a.     [Download]
>gi|292898313|ref|YP_003537682.1| hypothetical protein EAM_0591 [Erwinia amylovora ATCC 49946]
MTPQPAAQAEKIHRLHRLPPDFWAALCATPWRYDLFQLLRRLDAQGGQRYPLGRAPLPRHEPLRIGQRPS
LAFAPAAIASVSPRENSALHDVSIYSFGLFGPNGPLPIHLTEYARERSDHHQDNSLSAFADLFHHRLTLL
FYRAWADAQPTVALDRAEKRQFERWLASLIGMGQPGQLNQGSVSPHSRLALAGHLTRHARDAEGLQKMLS
HYFQVPVKLVENVPHWQPVDRRDRASLGAGRRKPRLGISAFLGVAVRDVQHKFRLELGPLPMNRYQRFLP
GEPWAQQLRDWVRQYLGIEFVWEVRLILDAADVQGVTLGGPSRLGYSSWLGQPAVPQHRSDLTFSPEPLA
EIAP
 
Nucleotide Sequence: 1065 bp     [Download]
>ref|NC_013971.1|:656594-657658 hypothetical protein EAM_0591 [Erwinia amylovora ATCC 49946]
ATGACACCGCAGCCCGCCGCGCAGGCAGAGAAAATTCACCGCCTGCATCGCCTGCCGCCGGACTTCTGGG
CGGCGCTGTGCGCCACGCCGTGGCGCTACGATCTGTTCCAGCTGCTGCGGCGGCTGGATGCGCAGGGCGG
CCAGCGCTATCCGCTGGGGCGTGCGCCGCTGCCGCGCCACGAGCCGCTGCGCATCGGCCAGCGGCCATCG
CTGGCCTTTGCCCCGGCGGCCATCGCCAGCGTCTCGCCGCGTGAAAACAGCGCGCTGCATGACGTGTCGA
TCTACAGCTTTGGCCTGTTTGGCCCCAACGGCCCGCTGCCGATCCATTTGACGGAGTATGCGCGCGAGCG
CAGCGACCATCATCAGGACAACAGCCTGAGCGCCTTTGCCGATCTGTTCCACCATCGCCTGACGCTGCTG
TTTTACCGCGCCTGGGCCGATGCGCAGCCCACGGTGGCGCTGGACCGGGCGGAAAAACGCCAGTTTGAGC
GCTGGCTCGCCAGCCTGATCGGCATGGGCCAGCCGGGGCAGCTTAACCAGGGTAGCGTTAGCCCGCACTC
ACGGCTGGCGCTGGCCGGGCATCTGACTCGTCACGCACGCGATGCAGAAGGGCTGCAAAAAATGCTCAGT
CACTACTTTCAGGTGCCGGTGAAGCTGGTGGAAAACGTGCCCCACTGGCAGCCGGTTGACCGCCGCGACC
GCGCCAGCCTGGGTGCGGGGCGGCGCAAACCGCGCCTCGGCATATCGGCCTTTCTCGGCGTGGCGGTGCG
CGATGTACAGCACAAATTTCGTCTGGAGCTGGGGCCGCTGCCGATGAACCGCTATCAGCGTTTTCTGCCC
GGCGAACCCTGGGCGCAGCAGCTGCGTGACTGGGTGCGTCAGTACCTGGGCATTGAGTTTGTCTGGGAGG
TGCGGCTGATCCTTGACGCCGCCGACGTGCAGGGCGTTACCCTTGGCGGCCCCTCCCGGCTGGGGTACAG
CAGCTGGCTGGGACAGCCCGCCGTGCCGCAGCACCGCAGCGATCTCACCTTTAGCCCGGAGCCGCTGGCG
GAGATTGCGCCCTGA