SecReT6
Protein ID: 292898316
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0594
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]661853..663817 [+]
ProductRhs family protein
NoteTssI
UniProt IDD4IFU2
KEGG IDeay:EAM_0594
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.40E-73, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.60E-25, Aligned region: 366..459
Protein Sequence: 654 a.a.     [Download]
>gi|292898316|ref|YP_003537685.1| Rhs family protein [Erwinia amylovora ATCC 49946]
MFDRITVQLPMDGLLFWRLSGREALSQSFELSVQLLSTDARIERRALLGQPITVCIPTQGLLNTRYLNGK
ITKVSVSSQALGGTRYAVYNLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVTLEDRLTGSYRSW
EYCVQYQESSFSFISRLMELEGIYYYFRHEADGHTLVLMDAAQQHRPFSGYEAIPYHVTPSGGSTREEGI
GLWSLEDSVTPGMYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYARIRQEVWQ
AEHQQISAAGTALGLAPGHTFTVLNAPFISDNGEYLTTEAYYEFEENRYASGDGSSGTKHNIAIRVIPSA
VTFRAPPETPWPRTHGPQTAKVVGPKGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRSKDGHKDAANALRFEDKA
GHEQIWIHAEKNMDTEVEHCETHDVGIDRHKTIGRDEKSTVKRNMLANVGVDATSNTGAKHTINVGGDQA
VLTMDKQGNALLEATASIRLKVKNNYILITPSAIEIQVAEGDLMAESEKGALFKGTDITLLGGGTNAELS
ANDTVSITGTNATDIKGALVKVNS
 
Nucleotide Sequence: 1965 bp     [Download]
>ref|NC_013971.1|:661853-663817 Rhs family protein [Erwinia amylovora ATCC 49946]
ATGTTTGATCGTATCACCGTGCAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCCTGAGCGGGCGCGAGG
CGCTGTCGCAGTCGTTTGAACTGAGCGTGCAGCTGCTAAGCACCGATGCGCGCATCGAGCGCCGGGCGCT
GCTCGGCCAGCCGATCACCGTATGCATTCCCACTCAGGGGCTGCTGAACACGCGCTACCTGAACGGCAAA
ATCACCAAAGTCTCGGTCAGCAGCCAGGCGCTGGGCGGCACGCGCTATGCCGTGTACAACCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGTGACAAAAATCTGCGCATTTTCCAGGGCCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGGCGAGTACAACGTGACGCTGGAAGATCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTCAGCTTTATCAGCCGCCTGATGGAGCTGGAAGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACACGCTGGTGCTGATGGACGCGGCGCAGCAGCACCGGCC
GTTCAGCGGCTACGAGGCGATCCCGTACCACGTCACGCCGTCCGGCGGCAGCACCCGCGAAGAGGGCATC
GGCCTGTGGTCGCTGGAGGACAGCGTAACGCCGGGGATGTACAGCATCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGCCTCGCCGCAGCCGGGCGCCATCGACGTCTACGA
CTGGCCGGGGCATTTCGTTGACCACGACCACGGCGAGTTCTATGCGCGCATCCGCCAGGAGGTGTGGCAG
GCGGAGCACCAGCAAATCAGCGCCGCCGGCACCGCGCTGGGGCTGGCGCCGGGCCACACCTTCACGGTAC
TGAACGCGCCGTTTATCAGCGATAACGGCGAGTACCTGACCACGGAGGCGTACTACGAATTTGAAGAGAA
CCGGTACGCCAGCGGCGACGGCAGCAGCGGCACGAAGCACAATATCGCCATCCGCGTGATCCCCTCCGCA
GTGACCTTCCGCGCGCCGCCGGAAACGCCGTGGCCGCGCACCCACGGCCCGCAGACGGCGAAGGTGGTGG
GTCCGAAGGGGGAATCGATCTGGACCGACAGATATGGCCGGGTGAAGGTGAAGTTCCACTGGGACCGGCT
GGCGAAGGGCGACGACACCAGCTCGTGTTGGGTGCGCGTCTCCAGCGCGTGGGCGGGCCAGGGCTACGGC
GGGGTACAGATCCCGCGGGTGGGCGACGAGGTGGTAGTCGACTTTATCAACGGCGATCCGGACCGGCCAA
TCATCACCGGGCGCGTGTACAACGAGGCCAGCATGCCGCCGTGGGCGCTGCCGGCCGCCGCGACGCAGAT
GGGCTTTATGAGCCGCTCGAAGGACGGACATAAAGACGCGGCCAACGCGCTGCGCTTTGAAGATAAGGCC
GGTCATGAGCAAATCTGGATCCATGCAGAAAAAAATATGGATACCGAGGTTGAGCACTGCGAAACCCATG
ATGTGGGCATCGATCGCCATAAAACCATTGGCCGCGACGAGAAAAGCACCGTTAAACGCAACATGCTGGC
TAACGTGGGCGTGGATGCGACCAGCAATACCGGGGCGAAACACACCATCAACGTGGGCGGGGATCAGGCC
GTTCTGACCATGGATAAGCAGGGCAACGCGTTGCTTGAAGCCACTGCCAGCATCAGGCTGAAGGTGAAAA
ATAATTATATCCTGATCACCCCCTCAGCCATCGAAATTCAGGTAGCGGAAGGGGACCTGATGGCGGAAAG
CGAGAAAGGGGCCTTATTTAAAGGCACAGACATTACCCTGCTGGGCGGCGGAACCAATGCGGAGCTAAGT
GCTAATGACACCGTCAGCATTACCGGAACCAACGCTACCGATATCAAAGGTGCGCTGGTCAAAGTGAACA
GCTAA

Protein ID: 292898320
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0598
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]666730..668664 [+]
ProductRhs family protein
NoteTssI
UniProt IDD4IFU6
KEGG IDeay:EAM_0598
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-73, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.50E-25, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 0.0031, Aligned region: 502..523
Gp5_C [PF06715], Evalue: 0.0031, Aligned region: 537..548
Protein Sequence: 644 a.a.     [Download]
>gi|292898320|ref|YP_003537689.1| Rhs family protein [Erwinia amylovora ATCC 49946]
MFDRITVQLPMDGLLFWRLSGREALSQSFELSVQLLSTDARIERRALLGQPITVCIPTQGLLNTRYLNGK
ITKVSVSSQALGGTRYAVYTLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVTLEDRLTGSYRSW
EYCVQYQESSFSFISRLMELEGIYYYFRHEADGHTLVLMDAAQQHRPFSGYEAIPYHVTPSGGSTREEGI
GLWSLEDSVTPGMYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYARIRQEVWQ
AEHQQISAAGTALGLAPGHTFTVLNAPFISDNGEYLTTEAYYEFEENRYASGDGSSGTKHNIAIRVIPSA
VTFRAPPETPWPRTHGPQTAKVVGPKGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKA
GEEQLWIQAERNMDTQVKNDESHQVGGNQSLTVQKTLNCSVSGHYNQQTQHTRTELVGDDYVLNVQGLLN
IASGAGIRLVSGDSMLILDPNGTISLQCSNLQINASGQGEINTGGTLDLNIQQPAKGAAPQPTPGEITSL
VNQAFKAPDSGSDA
 
Nucleotide Sequence: 1935 bp     [Download]
>ref|NC_013971.1|:666730-668664 Rhs family protein [Erwinia amylovora ATCC 49946]
ATGTTTGATCGTATCACCGTGCAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCCTGAGCGGGCGCGAGG
CGCTGTCGCAGTCGTTTGAACTGAGCGTGCAGCTGCTAAGCACCGATGCGCGCATCGAGCGCCGGGCGCT
GCTCGGCCAGCCGATCACCGTATGCATTCCCACTCAGGGGCTGCTGAACACGCGCTACCTGAACGGCAAA
ATCACCAAAGTCTCGGTCAGCAGCCAGGCGCTGGGCGGCACGCGCTATGCGGTGTACACCCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGTGACAAAAATCTGCGCATTTTCCAGGGCCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGGCGAGTACAACGTGACGCTGGAAGATCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTCAGCTTTATCAGCCGCCTGATGGAGCTGGAAGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACACGCTGGTGCTGATGGACGCGGCGCAGCAGCACCGGCC
GTTCAGCGGCTACGAGGCGATCCCGTACCACGTCACGCCGTCCGGCGGCAGCACCCGCGAAGAGGGCATC
GGCCTGTGGTCGCTGGAGGACAGCGTAACGCCGGGGATGTACAGCATCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGCCTCGCCGCAGCCGGGCGCCATCGACGTCTACGA
CTGGCCGGGGCATTTCGTTGACCACGACCACGGCGAGTTCTATGCGCGCATCCGCCAGGAGGTGTGGCAG
GCGGAGCACCAGCAAATCAGCGCCGCCGGCACCGCGCTGGGGCTGGCGCCGGGCCACACCTTCACGGTAC
TGAACGCGCCGTTTATCAGCGATAACGGCGAGTACCTGACCACGGAGGCGTACTACGAATTTGAAGAGAA
CCGGTACGCCAGCGGCGACGGCAGCAGCGGCACGAAGCACAATATCGCCATCCGCGTGATCCCCTCCGCA
GTGACCTTCCGCGCGCCGCCGGAAACGCCGTGGCCGCGCACCCACGGCCCGCAGACGGCGAAGGTGGTGG
GTCCGAAGGGGGAATCGATCTGGACCGACAGATATGGCCGGGTGAAGGTGAAGTTCCACTGGGACCGGCT
GGCGAAGGGCGACGACACCAGCTCGTGTTGGGTGCGCGTCTCCAGCGCGTGGGCGGGCCAGGGCTACGGC
GGGGTGCAGATCCCGCGGGTGGGCGACGAGGTGGTGGTGGACTTTATCAACGGCGACCCGGACCGGCCAA
TCATCACCGGGCGCGTGTACAACGAGGCCAGCATGCCGCCGTGGGCGCTGCCGGCCGCCGCGACGCAGAT
GGGCTTTATGAGCCGCTCGAAGGACGGCACGCCGGACAACGCCAACGCGCTGCGCTTCGAGGATAAGGCG
GGCGAGGAGCAGCTGTGGATCCAGGCCGAGCGCAATATGGATACCCAGGTGAAGAACGACGAAAGCCACC
AGGTGGGCGGTAATCAGTCTCTGACGGTGCAAAAAACGCTCAACTGCTCGGTATCAGGCCATTATAACCA
GCAGACGCAGCACACGCGCACGGAACTGGTCGGCGATGATTACGTTCTCAACGTGCAGGGCTTGCTGAAT
ATAGCCTCCGGTGCGGGCATCAGGCTGGTAAGCGGTGACAGCATGCTGATCCTTGATCCCAACGGCACCA
TTTCGCTGCAGTGCAGCAACCTGCAGATCAACGCCTCCGGGCAGGGGGAAATCAATACCGGCGGTACGCT
CGATCTCAATATCCAGCAGCCGGCTAAAGGCGCAGCCCCGCAGCCCACGCCGGGTGAGATCACCAGCCTG
GTGAACCAGGCCTTTAAAGCCCCGGATTCAGGGAGCGATGCATGA