SecReT6
Protein ID: 292898317
SecReT6 ID389
T6SS typei3
Gene symbol-
Locus tagEAM_0595
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]663840..664907 [+]
Producthypothetical protein
NotePAAR
UniProt IDD4IFU3
KEGG IDeay:EAM_0595
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.50E-19, Aligned region: 11..76
PAAR_motif [PF05488], Evalue: 6.50E-19, Aligned region: 187..203
PAAR_motif [PF05488], Evalue: 6.50E-19, Aligned region: 245..257
DUF4150 [PF13665], Evalue: 0.00019, Aligned region: 20..40
DUF4150 [PF13665], Evalue: 0.00019, Aligned region: 50..73
DUF4150 [PF13665], Evalue: 0.00019, Aligned region: 239..302
Protein Sequence: 355 a.a.     [Download]
>gi|292898317|ref|YP_003537686.1| hypothetical protein EAM_0595 [Erwinia amylovora ATCC 49946]
MGKPAARARIDNGAHSGPIQSGSPDVIIGGFPAARKGDTLSCSQHGGGIIVGGSASVIVNGRPLARRGDK
TQCHSGGKPPAQPPKAAPPQYWGATLAKNAAKDGLLHGDLYDARMLGAFASTEDKTGDGDPDTASLGFAW
ADLTLGNMKSGSLLRGESRTKVAFGNAGGTYYGYSGDSDIAGFNTSASASGVQYGGTAAAGRQSGLYGSI
TGDVTVATAETKLVGEVYKGNQGRYGFNAEAGAETAVVKGEAAVNIDVYGVFVSEAKLGGTGGGVGASAG
FTGYFDTTDYSINARLSGELAIVVGLKGDVSLKVAFKKIVDYIYKGVGGESEIIAKVDSGDGGVNTGCVT
VLIGD
 
Nucleotide Sequence: 1068 bp     [Download]
>ref|NC_013971.1|:663840-664907 hypothetical protein EAM_0595 [Erwinia amylovora ATCC 49946]
ATGGGTAAGCCAGCGGCCAGAGCGCGAATTGATAACGGCGCTCACAGTGGCCCAATACAATCCGGAAGCC
CTGATGTCATCATTGGCGGTTTCCCGGCGGCAAGGAAAGGCGACACGTTAAGCTGTTCGCAGCATGGCGG
CGGGATTATCGTCGGCGGTTCTGCCAGCGTAATCGTCAACGGACGACCTTTGGCGAGACGGGGAGATAAA
ACCCAGTGCCACAGCGGCGGGAAACCGCCCGCCCAGCCCCCTAAAGCCGCGCCGCCACAGTACTGGGGCG
CAACCCTGGCCAAAAACGCGGCTAAAGACGGGTTATTACACGGCGACCTCTACGATGCGCGCATGCTGGG
GGCTTTCGCCAGTACGGAAGATAAAACCGGCGATGGTGATCCAGACACCGCCTCGTTGGGATTTGCCTGG
GCAGACCTCACTTTGGGCAATATGAAAAGTGGCAGCCTGTTAAGGGGGGAAAGCCGTACTAAGGTTGCTT
TCGGCAATGCTGGCGGGACCTATTATGGCTATAGCGGTGATAGCGACATTGCCGGTTTTAACACCAGCGC
CTCTGCCAGCGGCGTTCAATATGGCGGAACAGCTGCAGCGGGAAGGCAGAGCGGACTGTACGGCAGTATC
ACCGGGGATGTAACGGTTGCCACCGCCGAAACAAAGCTTGTCGGTGAGGTATATAAAGGTAACCAGGGGC
GTTATGGATTTAACGCCGAAGCGGGCGCGGAAACGGCAGTCGTTAAGGGCGAGGCCGCGGTGAATATAGA
TGTCTATGGCGTTTTTGTATCGGAGGCTAAGCTCGGGGGGACTGGAGGTGGCGTAGGTGCATCTGCGGGA
TTTACAGGGTACTTCGATACTACCGATTATTCTATAAATGCACGTTTATCTGGCGAACTTGCGATAGTAG
TTGGCCTTAAAGGTGATGTTTCGTTGAAAGTTGCTTTCAAGAAAATCGTAGATTATATATATAAGGGTGT
GGGGGGTGAAAGTGAAATAATAGCTAAAGTTGATTCTGGTGATGGTGGGGTTAATACGGGTTGTGTCACG
GTTTTAATTGGGGATTGA