SecReT6
Protein ID: 294502594
SecReT6 ID390
T6SS typei3
Gene symbol-
Locus tagYPZ3_0484
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]586195..587208 [+]
Producthypothetical protein
NoteTssA
UniProt IDD5B0D3
KEGG IDypz:YPZ3_0484
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 183..203
Protein Sequence: 337 a.a.     [Download]
>gi|294502594|ref|YP_003566656.1| hypothetical protein YPZ3_0484 [Yersinia pestis Z176003]
MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCF
DLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKT
ARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQ
STESYQLHCEQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLD
RILEYFQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|294502110|ref|NC_014029.1|:586195-587208 Yersinia pestis Z176003 chromosome, complete genome
TTGATTTTAAAACGGATGGACAATAATATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATG
ATCCGGCCTATGGCGAGATTGAGTCCATCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCC
GCATGAACCCCCTCAAATAAACTGGCACCATATCAGTGAGCAAGCCAATAAGCTGCTAGAGCAATGTTTT
GATTTACGTGTAATGCTTTGGTTTATAAGGGCAAATATTCATATAAAAGGAATATCGGCCCTCTATGATG
GCTTTATGCGCATTAATGCACAAACCCAAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCC
ATTAAATAGTGGGCATGCCGCCGCATTAGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACT
GCACGCCTTACAGAAGAGCACCCTTACATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGCC
AAGAGAGATATTTTGTTACATCTTCGACATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATT
GCCAGATTTAAAAGACCAATTGACAAAAGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAA
TCCACAGAGAGTTACCAACTGCATTGTGAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTG
CACAATTGAATGCCCCAGAACATGACGATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCT
TGATACTCAGTCCTTTAATTCAAATGATAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGAC
CGTATTCTAGAGTACTTTCAACATTATGAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAG
AGATGATAGGTATGGATTTTTATTCCATTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACA
GTTTACCGGAAAAACTAACCTACCGTTTCGATGA