SecReT6
Protein ID: 294502598
SecReT6 ID390
T6SS typei3
Gene symbol-
Locus tagYPZ3_0488
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]590045..590488 [+]
Producthypothetical protein
NoteTssE
UniProt IDD5B0D7
KEGG IDypz:YPZ3_0488
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.70E-14, Aligned region: 23..123
Protein Sequence: 147 a.a.     [Download]
>gi|294502598|ref|YP_003566660.1| hypothetical protein YPZ3_0488 [Yersinia pestis Z176003]
MDISAPILFDKLSLRHEHVRLPHWREVIVRDIESLLNDSAHSARLKLKKYPHCEASVLNYGLPSLSQQVP
VITDLLELARHIQRIIATFESRLDPRSIKVVPLINKGETWVLAILFDIHARCNLPGEEHLVNLRIALDYS
YGMVRVL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|294502110|ref|NC_014029.1|:590045-590488 Yersinia pestis Z176003 chromosome, complete genome
ATGGATATTTCAGCACCGATACTTTTTGACAAATTAAGTCTCCGCCATGAACACGTTCGCTTACCTCATT
GGCGTGAAGTGATTGTGCGCGATATTGAATCTTTATTGAATGACTCCGCACACAGTGCCCGGTTGAAGCT
AAAAAAGTATCCGCATTGTGAGGCTTCTGTATTGAATTACGGGCTGCCTTCGCTCAGTCAGCAGGTACCG
GTAATCACCGACTTGCTGGAACTGGCCAGACATATACAGCGGATCATCGCCACGTTTGAGTCACGCCTGG
ATCCGCGCTCAATAAAAGTGGTGCCGCTGATTAATAAAGGCGAAACCTGGGTGTTAGCCATCCTGTTTGA
CATTCATGCCCGGTGCAACCTACCGGGCGAAGAGCACTTGGTCAATTTACGCATCGCGCTCGATTACTCC
TATGGAATGGTTCGCGTTCTTTAA