SecReT6
Protein ID: 294502600
SecReT6 ID390
T6SS typei3
Gene symbol-
Locus tagYPZ3_0490
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]592427..593341 [+]
Producthypothetical protein
NoteTssG
UniProt IDD5B0D9
KEGG IDypz:YPZ3_0490
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.70E-63, Aligned region: 2..289
Protein Sequence: 304 a.a.     [Download]
>gi|294502600|ref|YP_003566662.1| hypothetical protein YPZ3_0490 [Yersinia pestis Z176003]
MLRRIERATPEQGRLGTQRDRSHLRLRIIQPADMGFAPREVSDIRQTLNTHQHLAEITIFCRHFGLFAPY
GPLPIHVTEHARNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHVAVGHDRASANPFMNHVRQIAGLT
PQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEARKGLWIDDSRNIESQRMGRLGNTR
IGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRHRMVLDVQLIIQTSPNMACRLGGG
TLSRHSWLKPGSALSIQPIYRTVT
 
Nucleotide Sequence: 915 bp     [Download]
>gi|294502110|ref|NC_014029.1|:592427-593341 Yersinia pestis Z176003 chromosome, complete genome
TTGCTGCGTCGCATTGAGCGTGCCACTCCAGAGCAAGGCCGGCTTGGCACCCAACGTGATCGTAGCCATC
TGCGGCTACGTATTATTCAGCCTGCCGATATGGGATTTGCACCGCGTGAAGTGAGTGATATCAGGCAAAC
GCTGAACACTCATCAGCATCTGGCAGAGATCACCATTTTCTGCCGCCATTTTGGTTTATTTGCCCCGTAT
GGCCCGTTGCCAATACATGTTACCGAACATGCTCGTAACGAAGCGTTGGCTAAACGTAATCAGGCCTTTG
AACATTTTGCGGGCATTCTCAGCCAGCGAATGGCGATCTTGCATTATCGCTCTTGGGCCCAAATGCACGT
CGCCGTGGGGCATGATCGCGCGTCAGCCAATCCCTTTATGAACCATGTGCGTCAAATCGCGGGCCTAACG
CCGCAGCAAGCGCTGAATTCACATGTGGATCGGGTACGGCGTTGCTTTCCGGGGGTGTATCTGCCGGGCA
GAGGATCATTACGCAAATTACAGGAGATCCTGAGCCTGTATTTCTCGGTTCCTATCCGTGTTGAAGCCCG
TAAAGGATTGTGGATTGACGACTCGCGCAATATAGAAAGCCAACGTATGGGACGGTTGGGTAACACGCGT
ATTGGCAGCCGTTTCTTCGATGTGCAGCACAGCCTGGTGTTATCTATTGGTCCGGTATCTGACCCCCAAT
ATCTGGATTTTCAACGCAACAGCAAACGCATTAACACTCTGGTGCAAATCTGCCATGACTTTGTCCGCCA
TCGGATGGTGCTGGACGTGCAATTAATCATACAGACCTCACCCAATATGGCTTGTCGTCTTGGCGGTGGA
ACGCTCAGTCGCCATAGCTGGTTAAAGCCAGGCTCAGCCTTGAGTATACAGCCAATTTATAGAACGGTTA
CCTAG