SecReT6
Protein ID: 294502602
SecReT6 ID390
T6SS typei3
Gene symbol-
Locus tagYPZ3_0492
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]596051..598399 [+]
Producthypothetical protein
NoteTssI
UniProt IDD5B0E1
KEGG IDypz:YPZ3_0492
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 25..328
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 535..589
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 637..669
Phage_base_V [PF04717], Evalue: 2.30E-23, Aligned region: 365..457
Protein Sequence: 782 a.a.     [Download]
>gi|294502602|ref|YP_003566664.1| hypothetical protein YPZ3_0492 [Yersinia pestis Z176003]
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIELPDSAGYRTFF
TYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLR
EYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGI
QRIQRSQRIHSSEIVLRDFDFLNPRNTLQTHIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAI
QSNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDV
VYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGV
LAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQHASQLTFDDNR
GNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTG
TSLSVTGMSTSVTGVSVGFTLIGTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGTSNSMTG
SSHSMTGMSTSITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTG
SSTSTTGNSVSMTGNSTSTTGCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVG
VDLKTVGMQSKN
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|294502110|ref|NC_014029.1|:596051-598399 Yersinia pestis Z176003 chromosome, complete genome
ATGCAATTAATTGAGATAGAGAATGAGGTTTTATCGGGCCAGGATGCTTTTCCTCTCTCCTTCAAGACGC
AGGAAAAAGTGTCAGGGAATCCATCCTACCAACTGGTATTTCAGGTAGCAGAAGCGGATCTCGATCTGGT
CAGTTTGCTGGGGGAAATCATCAAAGTCAGGATTGAGTTACCTGACTCAGCCGGCTACCGGACCTTTTTT
ACCTATGTGATCGCCGGTGCTGATGAAGGGCAACGGCAAGACAAATTTGTTTACAGCCTGGAACTGAGTA
CCTGGACGTGGTTTTTGATGCAAAACCGCAACTGCCGGATATTTCAGGACCTGAATATTATCGATATTAT
CGAACAGGTATTCTCCAAATATAACTTTGCGGATTACCGTTTTGATATCGTCGGTAACTATCGATTACGC
GAGTACTGCGTACAGTTTGCAGAAACCGATTTCGACTTTGTTAATCGTCTGATGGAAGACGAAGGCGTTT
GGTATTACTTCGAACATAACGAAGATAAGCACACGCTGGTCATGACAGATCAGCAACAATTCCCTGTATT
GGAAGGGCATTATGCAGAACTGAGTTTCCTGCCTGACAGTGAAGAGATGCGCGCCATCCGTGAGGGGATA
CAGCGTATTCAACGCTCACAACGCATCCACTCCAGCGAAATTGTCTTACGTGACTTCGATTTCCTTAATC
CACGCAATACATTACAAACCCATATCGAAGAAAGCCGCCAACACCTGCAAGGCGTGCCACTGGAATGGTA
TGACTACGCGGCGGGTTACACCGATCCCCAGCATGGTGAGAGCATCGCCCGTTTACGCCTTGAAGCTATA
CAGAGTAATGGGCAGCTCTTGTCTGGTGAAAGTAATGCCACAGGATTAGTGCCAGGGCGCTCTTTTGCTC
TGGTACAGCACCCTGATAACAACCGTAATCGGGGATTCAAACTGATCAGTTGTGACTACAGTTTTGTCCA
GGATGGGCCGGACAGTGCGAGCCAGGGACGTAATGTCGCCTGTAAGTTTAAGGCATTGAATGATGACGTC
GTTTATCGTCCACAATGTGTCACGCCACCGCCAAAGGTCCCTGGTGTGCAAAGTGCCACAGTGGTCGGTG
CGCGTGAATCAGAAGTGCATACCGATAAGTTCGCCCGTATTCGCGTTCACTTTCACTGGGATCGTTATAA
AACCACCGAAGATGATAGCTCCTGCTGGATCCGCGTTGTACAGGCGTGGGCCGGTAAAGGCTGGGGCGTC
CTGGCGATGCCTCGGGTCGGGCAAGAAGTGCTGGTCAATTACGTTGACGGCGACCTTGATCGCCCGATGG
TGACCGGGATCGTCTACAACGGTGAGAACCCACCGCCTTACCGTTTACCTGACCACATTAACTACTCCGG
TTTTGTCTCACGCTCACTGCGCTTTGGTCAGCCACAACACGCCAGCCAGCTTACCTTCGATGATAATCGG
GGCAATGAGCGGATCATGCTACATGCTGAGCGCGACTTACAAAGAACGGTTGAACGTAACAGTGCGACGG
CCGTCGGTCAGGATAAATACGACACGGTGGAACGGACGGCCACGGAGTGGATCAACAACCATATCTCCTA
CAAAGACTTCAGTTTCTCGGTGACGGGCATGAGTGTCTCCGCGACGGGCATCAGTGTCTCGACAACGGGA
ACGAGCTTATCTGTCACCGGCATGAGCACCAGCGTCACGGGTGTCAGTGTGGGTTTCACCTTGATAGGGA
CCTCCTTTACGGGGGTGAGCACATCGTTTACCGGTGTCGGTACCTCCTTCACCGGGGCCAGCAACTCGCT
AACCGGTGTCAGCAACTCGATGACCGGGTGTAGTTCCTCCTTTACCGGTACTAGCAATAGCATGACAGGC
AGTAGCCATAGCATGACCGGCATGAGCACCAGCATCACCGGGCATAGCATGAGTCAGACGGGTTCCAGTA
GCAGCATCACCGGTGACAGTACCTCCTTTACCGGCAGCAGCGTCAGCAGTACGGGCAGCAGCGTCAGTAC
GACCGGTGTCAGTACCAGCACTACGGGGAGTAGCACCTCGACTACCGGTTGTAGCGTCAGTACTACGGGT
AGCAGCACCTCGACTACCGGTAATTCAGTCAGCATGACCGGTAACAGCACCAGTACCACGGGATGCAGTA
TTTCCACGACGGGCAGCAGTATTGGGACGGTAGGAAGCAGTATCAGCACCACGGGCAGTAGCGTCAGTAC
CACCGGTAGCAGTATCAGCACCACGGGATTATCCGTCAGTTATACCGGCGCTCAATATTCCGATGTGGGT
GTCGATCTGAAAACCGTTGGCATGCAAAGCAAAAACTGA