SecReT6
Protein ID: 294502607
SecReT6 ID390
T6SS typei3
Gene symbol-
Locus tagYPZ3_0497
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]602752..603225 [+]
Productlipoprotein
NoteTssJ
UniProt IDD5B0E6
KEGG IDypz:YPZ3_0497
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-17, Aligned region: 10..149
Protein Sequence: 157 a.a.     [Download]
>gi|294502607|ref|YP_003566669.1| lipoprotein [Yersinia pestis Z176003]
MLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIIELNKEGWSPPGL
YQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLTLKSDARADFN
RVVLVDGKALSLKASTK
 
Nucleotide Sequence: 474 bp     [Download]
>gi|294502110|ref|NC_014029.1|:602752-603225 Yersinia pestis Z176003 chromosome, complete genome
GTGTTGCCTATTTTTATCCTGACAGGTTGCGTCCTGCTCAGCGGCTGTAGCTGGTTTTCCTCATCCTCAG
AAGCGGCGCTACAGAAACGGCGGATTGACTTGCAGGTTGTTGCGGCTCCTCTCATCAATCCTGGGCCCAA
CGGTCAGGCACAGCCCTTGAAGGTATGCATTATTGAGCTGAATAAAGAGGGGTGGTCACCCCCCGGTTTG
TATCAGGGGACGCTCTGCAGTGGCATCAGTGTAGGAGGTGAAGTCGTCAGCGTGACGGAATACATCCTTG
CGCCGACAGAGGTGCGTCAATATTCCCGCGATGTTCCCTTTGAACAAGAGCGCTGGTGGGCAATAGCGGC
TGAGTTTCAGGAGATGAGTAACGGTAAAAGCCTATTAACGCTGAAATCTGATGCCCGTGCGGACTTCAAC
CGTGTGGTGCTCGTTGATGGTAAGGCCCTGTCATTAAAAGCGTCAACAAAGTAG