SecReT6
Protein ID: 294502609
SecReT6 ID390
T6SS typei3
Gene symbol-
Locus tagYPZ3_0499
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]604697..606307 [+]
Producthypothetical protein
NoteTssL
UniProt IDD5B0E8
KEGG IDypz:YPZ3_0499
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-43, Aligned region: 143..338
OmpA [PF00691], Evalue: 1.20E-12, Aligned region: 398..501
Protein Sequence: 536 a.a.     [Download]
>gi|294502609|ref|YP_003566671.1| hypothetical protein YPZ3_0499 [Yersinia pestis Z176003]
MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGN
NMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAW
DNAYIAAAMPLLLLVENIRSWPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFN
GLQTPDSYNQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLM
DLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNIL
TWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFINKKNIERLGL
ALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAIGRGESDPLAD
NATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|294502110|ref|NC_014029.1|:604697-606307 Yersinia pestis Z176003 chromosome, complete genome
ATGAACGAATTTGAACGCCAGATCCGTGCAGCCATTTCCGCAGCACGCAATGGCGCAAAACATGCGGAAC
AGTCACTGACTACACCAATGTGGCAAGCCAAAAGCACCGTAGCCTCATTGGGTGGGATTGTCCCTAGAAG
TGGCTCTTCGTCAACGTCACAGGCGGAGAACTATAAGGAAGGTCTCGCGGACCAGGCTGCCTCGGGCAAC
AACATGGCGCGCACGAGTGCGCCACCGGTCACTTTGTATCAGCAACAGCCAAATGCGAATGACAGCTATC
CAAACGGGAATAACAACAATCCAAACGGGGATAACAACAATCCAAACGGGAGTAACAACAATATAGCGAG
AGTACAGCGTATGCCGCATGGCATTTCCAGGGGCTTATATGAGCGCCCTGGGATGTTATTGGGTGCCTGG
GATAACGCCTATATTGCTGCGGCTATGCCTTTGCTGCTGCTGGTGGAAAATATTCGTAGCTGGCCGACGC
GTAACGCCGCAGAGGTCAGGCCACCGATTGTGCGGGAATTACAATATTTCCAGCAACATTTGCAGAAAAA
GAACTACCCGCAAGAAGACATTAACCACCTGTCTTACCTGCTATGTACCTATATCGATGGCATTTTTAAC
GGGCTGCAAACCCCAGACTCCTACAACCAAAGTCTGTTAGTGGAGTTTCACCGTGATGCCTGGGGGGGTG
AGGACTGCTTCGAACATCTGCGGGTCTATATGAACTCGCCGAAACAGTACCGGGAAGTTCTGGAATTCTA
TGATCTGATTATGTGCCTTGGTTTTGACGGTAAATACCAGATGATAGAGCATGGTGCGGTTCTGCTGATG
GATTTACGCAGCCGTCTCCACACGCAACTCTACGGTCAGGACGCCACACAATCTTTGGCTATCGCGCAAG
CGGTCAAAGGTTCTCCGCGTCGCCAATATATCAAGGCGCTGAAAATCTTCACCTATGGTTTCGCACTGTG
CCTTTGTGCTTACGGCGTCACGGCGTGGTATCTGCACCAGCAATCCCAACAGATCCGCAGCAACATTCTG
ACGTGGGTACTGCCTGAACCGCGGAAAATCAACATCATGGAGACCTTGCCGAATCCGCTATCCAACATCC
TGAATGAAGGGTGGCTGGAGGTCAGGAAAGATCCGCGTGGATGGCTATTAATCTTCACCTCCGACGGCGC
GTTCCGCACGGGTGAAGCGACCCTCTCGGAAGAGTTTATCAACAAGAAGAATATCGAACGTCTTGGGCTG
GCATTAGCCCCATGGCCGGGAGATATCGAGGTTATTGGTCATACGGATAACAAACCGTTCCGTAGCACTT
CCGGTAACAACAACCTCAAACTTTCCGCGGCCAGAGCATCGGTGGTGGCAGATAAACTGCGGGAATCCAC
TCAAATCAACGAAACCCATCAGCGAGAAATAAGTGCCATCGGACGGGGGGAGAGCGATCCTTTAGCTGAC
AATGCAACGGAAGAAGGGCGCAAGCGTAACCGGCGTGTGGATATCCTATGGAAAATTGGTCAGCGCGATG
CCGATAAGGCCATGAAGCAATTCCTGGAGAACCCAACACCAGAAGTTCAAGGAACGAATACCCAACAATA
G