SecReT6
Protein ID: 294502868
SecReT6 ID391
T6SS typei2
Gene symbol-
Locus tagYPZ3_0758
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]976625..977872 [+]
Producthypothetical protein
NoteTssK
UniProt IDD5B1X3
KEGG IDypz:YPZ3_0758
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-128, Aligned region: 4..412
Protein Sequence: 415 a.a.     [Download]
>gi|294502868|ref|YP_003566930.1| hypothetical protein YPZ3_0758 [Yersinia pestis Z176003]
MAVMHPWGVLQATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPVEASDATVMLAI
PQLYANGGNCLQPDERGERPVRHRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLR
DAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLFWLLNA
LNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEA
SLPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNV
ALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|294502110|ref|NC_014029.1|:976625-977872 Yersinia pestis Z176003 chromosome, complete genome
ATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGCCACTTTTGAATTGGATGCATTGGCACAGGGCCGCC
TGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGACGGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCT
GCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCGTCGAGGCCAGCGACGCCACGGTGATGCTGGCGATA
CCACAACTGTATGCCAATGGCGGTAACTGCCTGCAGCCGGATGAGCGGGGCGAACGCCCGGTACGCCATC
GTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGCGATGACAAAAAGCAGGTCGCGGTGATGTACCACCA
ACTGACCCTGCGGCTGGACACTCAGGAAAACGGCGATTATCAGGTCTGCCCGGTGGCGCGCTTGCTGCGG
GATGCGCAAGGTCGCTGGACACTGGATCCGGGCTTTATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCT
GGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAACTGCGGGCGCGTTTACAGCGTCTGATGGGGATGCG
CCGGGAGAGCAATGCACGGATGGCCGATTTTGCTGTCGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCC
CTTAACAGTGCCGAACCGGTACTGGGGAATTTTCAGCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATC
AGGAGCTGGCCAGGCTGGCGGGCAGCCTGCTGACGTTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGT
TTATCAGCATGAACAACTGACCCGCGTCTTTCCCCCGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCC
AGCCTCCCATCACGGGTGGTGGCGATTGAGCTGGTTCATGAACCGCGTATCAATCAGTGGCGCGCGACCC
TGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTCTACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCA
ATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCGGTGCGCCAGATGAGGTCGGTAACGTGGTGAATGTC
GCGTTGAGCGGGATCCCACTGCGTCCGCTGAGCCATGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACC
AGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCGACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTA
TGTACCCGGTACGCTGGGTGAGATCCAACTGGAGCTGTTTGCGGTGCTACGCGCATGA