SecReT6
Protein ID: 294503444
SecReT6 ID392
T6SS typei2
Gene symbol-
Locus tagYPZ3_1334
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]1725910..1726410 [+]
Producthypothetical protein
NoteTssB
UniProt IDD5B5F0
KEGG IDypz:YPZ3_1334
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|294503444|ref|YP_003567506.1| hypothetical protein YPZ3_1334 [Yersinia pestis Z176003]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEPESVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|294502110|ref|NC_014029.1|:1725910-1726410 Yersinia pestis Z176003 chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCGCTT
TGACCTTCCGCGAGATGAAAGATTTCGAACCGGAAAGCGTCGCCCGTCAAATCCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTCAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCACCAA
AAGAGGGTTAA