SecReT6
Protein ID: 294503448
SecReT6 ID392
T6SS typei2
Gene symbol-
Locus tagYPZ3_1338
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]1730044..1731780 [+]
Producthypothetical protein
NoteTagL
UniProt IDD5B5F4, D5B5F4
KEGG IDypz:YPZ3_1338
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.50E-15, Aligned region: 447..543
Protein Sequence: 578 a.a.     [Download]
>gi|294503448|ref|YP_003567510.1| hypothetical protein YPZ3_1338 [Yersinia pestis Z176003]
MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICMLGGSRAGRQAAGASSDPLFAGLATEN
GLLPENSRLPVVLVCGDGLASWFGRERSHQSAQGCWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVN
PQQRRDERLLAADLQELRWQLMQLRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGS
LADWQRAESRAVQAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVAPLAPQQIIQQQVASLADPVPASLW
QHWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLAAMVALCSSAW
QNRQLLHRVAFDIRQYHSVAMTDYSPKAQAVAVLRRDAGLLDEGYRNGEPLRLGLGLYRGERLRPPLLAA
IKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKPGWLIVVAGHTDITGDA
QANHILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQVPD
VKTASQDESDVSTQEMEK
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|294502110|ref|NC_014029.1|:1730044-1731780 Yersinia pestis Z176003 chromosome, complete genome
ATGAGTCGGTGGTGGCAACGTGGGTTGTGGCTCTGGGCGGGTTTGCTGGCGGTCATCTTGTGTCTGGCAT
TTCTGCCGCTCTCCCCGTGGGGGCGCTGGCTGATGCTGGCATGGGTGGTGCTGATTTGCATGCTGGGCGG
GTCGCGGGCAGGGCGGCAAGCGGCCGGTGCATCCTCTGATCCGCTGTTCGCCGGGTTGGCAACTGAAAAC
GGTCTTCTGCCTGAAAACAGTCGCTTACCGGTGGTGTTGGTATGTGGTGATGGTCTGGCGTCATGGTTTG
GTCGCGAACGGTCACACCAGAGTGCACAGGGCTGCTGGCTGCGGGTGGATGATATCAGCACCCTGCGGCA
GTTTGCCCGACAACTGCTGTGGCAACGGCCGGAATGGGCCGCTCAGTTGGCGGTGATGATGGTCGTGAAC
CCGCAGCAACGCCGCGATGAGCGCCTGCTGGCCGCCGATCTGCAAGAGCTGCGCTGGCAACTGATGCAAC
TGCGCCGCGATAGCCGCCATCCTGTTCCCTTGCTCCTGAGCAGCACGGTGGCCACCTCGGTTGCCCGTGA
TACGGTCTGGCTGTCACAGCAGCAGACACCGCCGCTGACACTCTGGTCAACCGTCTCGACGCCGGGCTCT
CTGGCCGACTGGCAGCGTGCGGAAAGCCGTGCCGTACAGGCCGAACGACTGAAACAGGCGGTGCTGTTCA
GCAGCCAGCATGACTGGCTGAACGCACAGGTGCTGCCGGTATTGCAGGCACCCAATGCGGATGTTGCCCC
CCTTGCCCCGCAACAGATTATTCAACAGCAGGTTGCCAGTCTGGCCGATCCGGTGCCTGCCTCGCTGTGG
CAGCACTGGCTGGCGGCGCATACCACGCTGACACAGGTGGCGGGTTGGCATCCACCGCCGCCCGCCGCCC
ATGACGCCTTACCGCTGCCGGATTTTGTCTTTTCAGCGCTTCCTCTTGGTAGCGGGGTGTCGTCACGCCG
TCGGGTACTGCGCCATGGTGTCACCTTACTGACGTTGGCGGCGATGGTGGCGTTGTGCAGCAGCGCCTGG
CAGAACCGGCAACTGTTGCACCGGGTGGCCTTTGATATCCGTCAGTACCACAGCGTGGCGATGACGGATT
ATTCCCCGAAAGCGCAGGCGGTGGCGGTATTACGCCGTGATGCGGGGCTGCTTGATGAAGGGTACCGCAA
CGGTGAACCGCTGCGTCTGGGCCTGGGGTTATATCGGGGGGAGCGGCTGCGCCCGCCGCTGTTGGCGGCG
ATCAAAAGCTACATCCCGCCCCCTCCGCCCCCTCCCGCGCCACCGGCGCCGAAAACCGTGCGCCTCGACA
GCCTGTCACTGTTCGATGTGGGTAAATTCACGCTGAATGCGGGGTCCACCAAAATGCTGGTCACGGCGCT
GATCGACATCAAAGCCAAACCCGGCTGGCTGATCGTGGTGGCCGGGCATACCGACATCACCGGCGATGCG
CAGGCCAACCACATTCTGTCGCTTAAGCGCGCCGAAGCATTACGCGACTGGATGCTGTCAACCAGCGACG
TCTCGCCGACCTGCTTTGCGGTGCAAGGTTACGGGGCCACACGCCCTATCGCCGACAACGATACTCCCGA
CGGTCGGGCGCTCAACCGCCGGGTCGAAATCAGTCTGGTACCACAGGCTGATGCCTGTCAGGTGCCGGAT
GTAAAAACAGCGTCACAGGATGAAAGTGACGTATCAACGCAAGAAATGGAGAAGTAA