SecReT6
Protein ID: 294503461
SecReT6 ID392
T6SS typei2
Gene symbol-
Locus tagYPZ3_1351
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]1757472..1758530 [+]
Producthypothetical protein
NotePAAR
UniProt IDD5B5G7
KEGG IDypz:YPZ3_1351
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 6.20E-28, Aligned region: 194..303
PAAR_motif [PF05488], Evalue: 3.50E-10, Aligned region: 10..65
Protein Sequence: 352 a.a.     [Download]
>gi|294503461|ref|YP_003567523.1| hypothetical protein YPZ3_1351 [Yersinia pestis Z176003]
MAKGYYLGVGDETTCGGVIIEGDATHVLMGKAVAREQDRVTCGKHPGTYIIIGHVPGDSVNGRKFAGTLN
SQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESEEKSKVVCAHIDGALVVASYI
LDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYARMNAPPQPEIISASVLWFMAVKSGAKWDHKP
KIRDQFKAYAVSRPLVGSGTRSKSYFHKYEEHDYFYDVWSNIHYGYVGLSLGFDESYLLLGSTLEQVRTS
IGSKPDPIDDITCMKIGYALYHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNNDNSSQIDHPQ
GK
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|294502110|ref|NC_014029.1|:1757472-1758530 Yersinia pestis Z176003 chromosome, complete genome
ATGGCAAAAGGCTATTACCTTGGGGTTGGGGATGAAACAACCTGCGGCGGCGTGATCATCGAAGGTGACG
CCACACATGTCTTGATGGGTAAAGCGGTGGCCCGTGAACAAGACAGAGTGACCTGCGGTAAACATCCGGG
AACCTATATTATTATCGGCCATGTTCCTGGCGATTCGGTAAATGGCCGCAAGTTTGCGGGCACCTTGAAT
AGTCAAAGCAATTGCCCGTGCAAGGCGTGGTTTATTCCTTCTTTGGTGCATGATACGTATGAGTTTGGTG
CAAGAAGTAAATCACAAAATATGTCTGAAATTAGTACTGAAGTCGAACGTGAGATGGTAGAAAATGTGAG
TGAATCAGAAGAAAAATCTAAAGTTGTCTGTGCCCATATTGATGGCGCTTTAGTAGTAGCGAGTTATATC
CTTGATGAAATAAAGAAAAATGTAAAAAGTGATACCGCTGATAAAATCAGATCTTTTATCGATAATGACC
TCTATAAAAAAAGACTTAAGGAGTGGCAGGATTCTCCTTGGTACGCGAGAATGAATGCACCTCCACAGCC
TGAAATAATATCGGCATCGGTTTTATGGTTTATGGCGGTCAAGAGTGGTGCTAAATGGGATCATAAACCT
AAAATTAGAGATCAATTTAAAGCATATGCAGTTTCTCGTCCTCTGGTCGGAAGCGGAACCCGATCAAAAA
GCTATTTTCATAAATATGAAGAACATGATTATTTTTATGATGTCTGGTCCAATATTCACTATGGTTATGT
AGGCTTAAGTCTTGGTTTTGATGAGTCATATTTATTACTTGGCTCAACTCTTGAGCAAGTAAGAACCAGC
ATCGGGAGTAAACCAGATCCTATAGATGATATTACATGTATGAAAATTGGCTATGCACTCTATCATCAAC
ATGGAAAATATGCTGAGACGTTAGATGTCAGGCATATACTCGATGCTCTTGAATCAGCATCGGACCTTGA
TCTAGCTATTTCAAGACAAATTCATTGGTGTTGGAATAATGATAATTCGAGTCAAATTGATCACCCGCAG
GGTAAGTAA