SecReT6
Protein ID: 294503464
SecReT6 ID392
T6SS typei2
Gene symbol-
Locus tagYPZ3_1354
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]1760948..1762033 [+]
Producthypothetical protein
NoteTssG
UniProt IDD5B5H0
KEGG IDypz:YPZ3_1354
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-81, Aligned region: 19..319
Protein Sequence: 361 a.a.     [Download]
>gi|294503464|ref|YP_003567526.1| hypothetical protein YPZ3_1354 [Yersinia pestis Z176003]
MGRESSVPPSRLITRLKRDIGQINFYRFCQLLEQQPGTLPLGSTNSPADDPVRFRPHPGMGFPVSELKAL
ENDPLHPEAPLTARTTFMGLYGVDSPLPTAYIDDITQQREGHEALEGFLDIFNHRFMTQFYRIWRKYSYP
ATFESGGTDNTSQSLLGLIGMGIPGSQQHFATPTSRFLALLGVMRQPGRTAEGVQALVRLLAPFTEADVT
PHCLRTVRLTSPMAFADEGANWLDGYTVLGDEAIDANSQLLISLRTADRDEAANWLPDGPLYTDFLVLLR
VYLGWRYRACIQLTVATRLLPALVLDETPIRLGLTGVLGLDDATLSDDIPEYFTVALGHYRGLAPQQHQE
GNRRVNYRLEK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|294502110|ref|NC_014029.1|:1760948-1762033 Yersinia pestis Z176003 chromosome, complete genome
ATGGGAAGAGAATCATCAGTCCCGCCTTCCCGGCTAATCACCCGGCTTAAGCGCGATATCGGCCAGATCA
ATTTTTACCGTTTCTGTCAGTTGCTGGAGCAACAACCGGGAACCTTGCCGCTCGGCAGTACCAACAGCCC
GGCGGATGATCCGGTGCGTTTTCGTCCGCATCCCGGCATGGGTTTTCCGGTCAGTGAACTGAAGGCGCTG
GAAAACGACCCGCTGCATCCGGAAGCCCCGTTGACCGCGCGCACCACCTTTATGGGGTTGTACGGGGTGG
ATTCGCCTTTGCCGACGGCCTATATCGACGATATCACCCAGCAGCGCGAAGGGCATGAGGCGCTGGAAGG
GTTCCTCGATATTTTCAACCACCGTTTTATGACGCAGTTTTATCGCATCTGGCGCAAATATTCCTATCCG
GCCACTTTTGAGTCGGGCGGCACAGACAATACCTCTCAGAGCCTGTTGGGGCTGATAGGCATGGGTATTC
CTGGCTCACAGCAGCATTTTGCCACCCCGACATCGCGCTTTCTGGCCTTGCTGGGGGTGATGCGACAACC
GGGGCGCACTGCCGAAGGGGTACAGGCGCTGGTCCGGCTGCTGGCCCCGTTTACCGAGGCGGATGTCACG
CCCCATTGCCTGCGCACGGTGCGCCTGACTTCTCCGATGGCGTTTGCCGATGAAGGGGCCAACTGGCTGG
ACGGCTACACCGTGCTGGGTGATGAGGCCATTGATGCCAACAGTCAGTTGCTGATTTCGCTGCGCACGGC
AGACCGCGACGAGGCCGCTAACTGGTTACCGGATGGCCCGCTGTATACCGATTTTCTGGTGCTGTTGCGG
GTCTATCTGGGCTGGCGTTACCGGGCCTGTATCCAACTGACGGTCGCCACCCGGTTGCTGCCGGCGTTGG
TGTTGGATGAGACACCGATAAGGCTGGGATTAACCGGCGTGCTGGGGCTGGATGACGCGACGCTGTCAGA
CGATATACCTGAATATTTTACCGTGGCGCTGGGCCACTACCGTGGGCTGGCTCCACAGCAACATCAAGAA
GGAAACCGACGTGTTAACTACCGTTTGGAAAAATAA