SecReT6
Protein ID: 294503465
SecReT6 ID392
T6SS typei2
Gene symbol-
Locus tagYPZ3_1355
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]1762008..1762589 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD5B5H1
KEGG IDypz:YPZ3_1355
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-39, Aligned region: 31..186
Protein Sequence: 193 a.a.     [Download]
>gi|294503465|ref|YP_003567527.1| hypothetical protein YPZ3_1355 [Yersinia pestis Z176003]
MLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIKVLHLDFTARE
ALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPME
KETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLELGNNSLTLRTEKK
 
Nucleotide Sequence: 582 bp     [Download]
>gi|294502110|ref|NC_014029.1|:1762008-1762589 Yersinia pestis Z176003 chromosome, complete genome
GTGTTAACTACCGTTTGGAAAAATAAAACCTGTACTTCGAAACATAAAAGCTGGGCCGCCTGGAAAAATA
AAATCTGCATCCCCGCACTGGTCTTGTTGCTCAGTGGCTGCGGGCTGACGCAAGCCGTGACCGATAGCAC
CGTGTCGGCCACAAAATCACTGTTTTATAAGCAGATAAAGGTGCTGCATCTGGACTTTACCGCCCGTGAA
GCCCTGAATACCGATGCGCACGAGGCGAACTCGTCATCGGAGCCGGTAATGGTGCGGGTTTATCAGTTAC
GTGATGATAAAACCTTCCTCAAAACGGTGTATCAACAACTGGCAAGCGACGGGGAGGCGGCGCTTAAAGA
TGACCTGCTGGCCAGCCGCAGTGTGGTGGTGAAACCGGGCGGGGCGGTAACACTGGATATGCCGATGGAA
AAAGAGACCCAGTTTGTGGCAGTGGTGGCGCTGTTCCGTCATCCGGATATGGCCAAAGACCACTGGCGTC
TGATACTCACGCTGGACGACCTGCATCCCGATAAGCCCCGTACCCTTGAGTTGGGTAATAACAGCCTGAC
CCTGCGGACGGAGAAAAAATAA