SecReT6
Protein ID: 294504692
SecReT6 ID393
T6SS typei3
Gene symbol-
Locus tagYPZ3_2582
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]3331337..3331942 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDD5B0L9
KEGG IDypz:YPZ3_2582
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-29, Aligned region: 65..177
Protein Sequence: 201 a.a.     [Download]
>gi|294504692|ref|YP_003568754.1| DotU family type IV / VI secretion system protein [Yersinia pestis Z176003]
MDESPQALGRFLLDEPMTSPDSTQDNTAFTREAPHSGAAQQYDTTLLRGESVQQRVAKVLASSTPLLEAA
QPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMAIVRYCLCTALDEAAHTMSWGM
MAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYAVTNGAIVIHTQRLKSDPGGNLLS
 
Nucleotide Sequence: 606 bp     [Download]
>gi|294502110|ref|NC_014029.1|:c3331942-3331337 Yersinia pestis Z176003 chromosome, complete genome
GTGGATGAGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAGCCAATGACATCCCCAGATAGCACTC
AGGATAATACGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTT
ACGGGGTGAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCA
CAGCCACTATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAA
AACAAAGCCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAA
AATGGCTATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATG
ATGGCAGGTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTT
TCTTATTGGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCTGTAACGAACGGTGCAATAGTGATCCA
CACCCAACGCCTGAAATCAGATCCAGGGGGTAATCTGCTCTCCTGA